Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE M04/GP34 MOUSE CYTOMEGALOVIRUS IMMUNOEVASIN CORE DOMAIN
 
Authors :  N. G. Sgourakis, K. Natarajan, D. H. Margulies, A. Bax
Date :  21 Dec 13  (Deposition) - 16 Jul 14  (Release) - 22 Oct 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Mhc Class-I Regulation, Immunoglobulin-Like Fold, Natural Killer Decoy, Missing-Self, Rosetta Modelling, Ilv Labelling, Residual Dipolar Couplings, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. G. Sgourakis, K. Natarajan, J. Ying, B. Vogeli, L. F. Boyd, D. H. Margulies, A. Bax
The Structure Of Mouse Cytomegalovirus M04 Protein Obtained From Sparse Nmr Data Reveals A Conserved Fold Of The M02-M0 Viral Immune Modulator Family.
Structure V. 22 1263 2014
PubMed-ID: 25126960  |  Reference-DOI: 10.1016/J.STR.2014.05.018

(-) Compounds

Molecule 1 - M04 IMMUNOEVASIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPLASMID
    GeneM04
    MutationYES
    Organism CommonMUHV-1
    Organism ScientificMURINE CYTOMEGALOVIRUS
    Organism Taxid69156
    StrainK181

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2MIZ)

(-) Sites  (0, 0)

(no "Site" information available for 2MIZ)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:26 -A:147
2A:47 -A:142

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2MIZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2MIZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2MIZ)

(-) Exons   (0, 0)

(no "Exon" information available for 2MIZ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:156
 aligned with A2Q6L0_MUHVK | A2Q6L0 from UniProtKB/TrEMBL  Length:266

    Alignment length:156
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182       192      
         A2Q6L0_MUHVK    43 RHSLGCYFKGINPTKVPSSDPRTILKCTLPDVKVNASWTLEWVVVNLHTSVDVTSYYESSPNSEPRFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYG 198
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
     Sec.struct. author (1) .....................................................................................-hhhh......................hhhhhh....................hhhhhhhhhhhhh..... Sec.struct. author (1)
     Sec.struct. author (2) -------------------------------------------------------------------------------------eee-------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2miz A  21 RHSLGCYFKGINPTKVPSSDPRTVLKCTLPDVKVNASWTLEWVVVNLHTSVDVTSYYESSPNSEPRFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYG 176
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2MIZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2MIZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2MIZ)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (A2Q6L0_MUHVK | A2Q6L0)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2miz)
 
  Sites
(no "Sites" information available for 2miz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2miz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2miz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A2Q6L0_MUHVK | A2Q6L0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A2Q6L0_MUHVK | A2Q6L0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2MIZ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2MIZ)