Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CSR/RSM PROTEIN-RNA RECOGNITION - A MOLECULAR AFFINITY RULER: RSMZ(SL2)/RSME(DIMER) 2:1 COMPLEX
 
Authors :  O. Duss, N. Diarra Dit Konte, E. Michel, M. Schubert, F. H. -T. Allain
Date :  11 Oct 13  (Deposition) - 26 Feb 14  (Release) - 14 May 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C,D  (20x)
NMR Structure *:  A,B,C,D  (1x)
Keywords :  Csra, Rsma, Rsme, Rsmz, Csrb, Translation Repressor Protein, Translation Activation, Protein Sequestration, Bacterial Protein, Non-Coding Rna, Srna, Pseudomonas Aeruginosa, Rna-Binding Proteins, Messenger Rna, Modulation Of Binding Affinity, Molecular Mimicry, Translation-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  O. Duss, E. Michel, N. Diarra Dit Konte, M. Schubert, F. H. Allain
Molecular Basis For The Wide Range Of Affinity Found In Csr/Rsm Protein-Rna Recognition.
Nucleic Acids Res. V. 42 5332 2014
PubMed-ID: 24561806  |  Reference-DOI: 10.1093/NAR/GKU141

(-) Compounds

Molecule 1 - CARBON STORAGE REGULATOR HOMOLOG
    Chains: A, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET28A
    Gene: RSME, CSRA
    Organism Scientific: PSEUDOMONAS FLUORESCENS
    Organism Taxid: 294
 
Molecule 2 - SL2(RSMZ) RNA
    Chains: B, D
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
NMR Structure (20x): ABCD
NMR Structure * (1x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2MFE)

(-) Sites  (0, 0)

(no "Site" information available for 2MFE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2MFE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2MFE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2MFE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2MFE)

(-) Exons   (0, 0)

(no "Exon" information available for 2MFE)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:59
 aligned with Q5MXB2_PSEFL | Q5MXB2 from UniProtKB/TrEMBL  Length:64

    Alignment length:59
                                    10        20        30        40        50         
          Q5MXB2_PSEFL    1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 59
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...eeee...eeeeeeeee..eeeeeee......eeehhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                  2mfe A  1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 59
                                    10        20        30        40        50         


Chain B from PDB  Type:RNA  Length:22
                                                     
                  2mfe B 17 GGGCCAUCAAGGACGAUGGUCC 38
                                    26        36  


Chain C from PDB  Type:PROTEIN  Length:59
 aligned with Q5MXB2_PSEFL | Q5MXB2 from UniProtKB/TrEMBL  Length:64

    Alignment length:59
                                    10        20        30        40        50         
          Q5MXB2_PSEFL    1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 59
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...eeee...eeeeeeeee..eeeeeee......eeehhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                  2mfe C  1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD 59
                                    10        20        30        40        50         


Chain D from PDB  Type:RNA  Length:22
                                                     
                  2mfe D 17 GGGCCAUCAAGGACGAUGGUCC 38
                                    26        36
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2MFE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2MFE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2MFE)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A,C   (Q5MXB2_PSEFL | Q5MXB2)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
biological process
    GO:0006402    mRNA catabolic process    The chemical reactions and pathways resulting in the breakdown of mRNA, messenger RNA, which is responsible for carrying the coded genetic 'message', transcribed from DNA, to sites of protein assembly at the ribosomes.
    GO:0006109    regulation of carbohydrate metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving carbohydrates.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2mfe)
 
  Sites
(no "Sites" information available for 2mfe)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mfe)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2mfe
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5MXB2_PSEFL | Q5MXB2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5MXB2_PSEFL | Q5MXB2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q5MXB2_PSEFL | Q5MXB2: 2jpp 2mfc 2mff 2mfg 2mfh

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2MFE)