|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MC6) |
Sites (0, 0)| (no "Site" information available for 2MC6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MC6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MC6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MC6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MC6) |
Exons (0, 0)| (no "Exon" information available for 2MC6) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:73 aligned with Q8LTJ5_9CAUD | Q8LTJ5 from UniProtKB/TrEMBL Length:73 Alignment length:73 10 20 30 40 50 60 70 Q8LTJ5_9CAUD 1 MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR 73 SCOP domains ------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 2mc6 A 1 MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR 73 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:10 aligned with RPOC_XANOR | Q8KTH8 from UniProtKB/Swiss-Prot Length:1405 Alignment length:10 10 RPOC_XANOR 1 MKDLLNLFNQ 10 SCOP domains ---------- SCOP domains CATH domains ---------- CATH domains Pfam domains ---------- Pfam domains SAPs(SNPs) ---------- SAPs(SNPs) PROSITE ---------- PROSITE Transcript ---------- Transcript 2mc6 B 1 MKDLLNLFNQ 10 10
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MC6) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MC6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MC6) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain B (RPOC_XANOR | Q8KTH8)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|