Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE PUTATIVE RAS INTERACTION DOMAIN OF AFD-1, ISOFORM A FROM CAENORHABDITIS ELEGANS
 
Authors :  R. Harris, B. Hillerich, M. Ahmed, J. B. Bonanno, S. Chamala, B. Evans, J J. Hammonds, E. Washington, M. Stead, J. Love, J. Attonito, R. D. Seide R. C. Liddington, W. I. Weis, W. J. Nelson, M. E. Girvin, S. C. Almo, New Structural Genomics Research Consortium (Nysgrc), Assembly, D And Evolution Of Cell-Cell And Cell-Matrix Adhesions (Cellm
Date :  07 Feb 13  (Deposition) - 20 Mar 13  (Release) - 20 Mar 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Structural Genomics, Unknown Function, Thioredoxin-Like, New York Structural Genomics Research Consortium, Nysgrc, Assembly, Dynamics And Evolution Of Cell-Cell And Cell-Matrix Adhesions, Cellmat, Psi- Biology (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Harris, B. Hillerich, M. Ahmed, J. B. Bonanno, S. Chamala, B. Evans, J. Lafleur, J. Hammonds, E. Washington, M. Stead, J. Love, J. Attonito R. D. Seidel, Y. M. Chook, M. P. Rout, R. C. Liddington, W. I. Weis, W. J. Nelson, M. E. Girvin, S. C. Almo
Solution Structure Of The Putative Ras Interaction Domain O Afd-1, Isoform A From Caenorhabditis Elegans
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN AFD-1, ISOFORM A
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: MODIFIED PET28A
    Expression System Vector Type: PET
    Fragment: UNP RESIDUES 214-320
    Gene: AFD-1, W03F11.6
    Organism Common: NEMATODE
    Organism Scientific: CAENORHABDITIS ELEGANS
    Organism Taxid: 6239

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2M4N)

(-) Sites  (0, 0)

(no "Site" information available for 2M4N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2M4N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M4N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2M4N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2M4N)

(-) Exons   (0, 0)

(no "Exon" information available for 2M4N)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with Q9BIC1_CAEEL | Q9BIC1 from UniProtKB/TrEMBL  Length:1658

    Alignment length:108
                                   222       232       242       252       262       272       282       292       302       312        
         Q9BIC1_CAEEL   213 MMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPH 320
               SCOP domains d2m4na_ A: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeee.........eeeee.....hhhhhhhhhhhhh.hhhhhh.eeeeeee................eee.....hhhhhhhhh........eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 2m4n A   1 SMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPH 108
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M4N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M4N)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q9BIC1_CAEEL | Q9BIC1)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2m4n)
 
  Sites
(no "Sites" information available for 2m4n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m4n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m4n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9BIC1_CAEEL | Q9BIC1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9BIC1_CAEEL | Q9BIC1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2M4N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2M4N)