Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF GAMMAM7-CRYSTALLIN
 
Authors :  B. Mahler, Z. Wu
Date :  16 Jan 13  (Deposition) - 28 Aug 13  (Release) - 25 Dec 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Beta/Gamma Crystallin, Fish Lens, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Mahler, Y. Chen, J. Ford, C. Thiel, G. Wistow, Z. Wu
Structure And Dynamics Of The Fish Eye Lens Protein, Gamma M7-Crystallin.
Biochemistry V. 52 3579 2013
PubMed-ID: 23597261  |  Reference-DOI: 10.1021/BI400151C

(-) Compounds

Molecule 1 - CRYSTALLIN, GAMMA M7
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Variant: PLYSS
    Expression System Vector: PET
    Gene: CRYGM7, DKEY-57A22.1-001
    Organism Common: LEOPARD DANIO,ZEBRA DANIO,ZEBRA FISH
    Organism Scientific: DANIO RERIO
    Organism Taxid: 7955
    Synonym: GAMMAM7-CRYSTALLIN, UNCHARACTERIZED PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2M3C)

(-) Sites  (0, 0)

(no "Site" information available for 2M3C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2M3C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M3C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2M3C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2M3C)

(-) Exons   (0, 0)

(no "Exon" information available for 2M3C)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:174
 aligned with Q5XTN3_DANRE | Q5XTN3 from UniProtKB/TrEMBL  Length:174

    Alignment length:174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    
         Q5XTN3_DANRE     1 MGKIIFYEDRNFGGRYHECMSDCADLHSYFNRCHSIRVESGCFMVYDRTNFMGRQYFLRRGEYPDYMRTMGMNDCVRSCRMIPLHHGSFKMRLYEHSDMGGRMMELMDDCPNLMDRFNMSDFHSCHVMDGHWLVYEQPNYTGRQFYLRPGEYRSYNDWGGVTSRMGSIRRITDL 174
               SCOP domains d2m3ca1 A:1-86 automated matches                                                      d2m3ca2 A:87-174 automated matches                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee........eeee...............eeeeeeeeeeeeee...eeeeeeeeeeee..............eeeee........eeee........eeee.....hhhhhh......eeee....eeeeee...eeeeeee..eee..............eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2m3c A   1 MGKIIFYEDRNFGGRYHECMSDCADLHSYFNRCHSIRVESGCFMVYDRTNFMGRQYFLRRGEYPDYMRTMGMNDCVRSCRMIPLHHGSFKMRLYEHSDMGGRMMELMDDCPNLMDRFNMSDFHSCHVMDGHWLVYEQPNYTGRQFYLRPGEYRSYNDWGGVTSRMGSIRRITDL 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M3C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M3C)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 2M3C)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2m3c)
 
  Sites
(no "Sites" information available for 2m3c)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m3c)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m3c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5XTN3_DANRE | Q5XTN3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5XTN3_DANRE | Q5XTN3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2M3C)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2M3C)