2M2F - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   THE MEMBRAN-PROXIMAL DOMAIN OF ADAM17

Authors :   S. Duesterhoeft, S. Jung, C. Hung, A. Tholey, F. D. Soennichsen, J. Groe I. Lorenzen

Date :   20 Dec 12 (Deposition) - 10 Apr 13 (Release) - 19 Jun 13 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)
NMR Structure *: A  (1x)

Keywords :   Adam17, Membrane-Proximal Domain, Hydrolase Regulator, Closed Conformer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Dusterhoft, S. Jung, C. W. Hung, A. Tholey, F. D. Sonnichsen, J. Grotzinger, I. Lorenzen
Membrane-Proximal Domain Of A Disintegrin And Metalloprotease-17 Represents The Putative Molecular Switch Of Its Shedding Activity Operated By Protein-Disulfide Isomerase.
J. Am. Chem. Soc. V. 135 5776 2013
PubMed-ID: 23521534 | Reference-DOI: 10.1021/JA400340U

Molecule 1 - DISINTEGRIN AND METALLOPROTEINASE DOMAIN-CONTAINING PROTEIN 17
	Chains	:	A
	EC Number	:	3.4.24.86
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 581-642
	Gene	:	ADAM17, CSVP, TACE
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ADAM 17, SNAKE VENOM-LIKE PROTEASE, TNF-ALPHA CONVERTASE, TNF-ALPHA-CONVERTING ENZYME

		1
NMR Structure (20x)	:	A
NMR Structure * (1x)	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2M2F)

(no "Site" information available for 2M2F)

NMR Structure

No.	Residues
1	A:2	-	A:24
2	A:11	-	A:31
3	A:13	-	A:23
4	A:20	-	A:55
5	A:50	-	A:61

(no "Cis Peptide Bond" information available for 2M2F)

(no "SAP(SNP)/Variant" information available for 2M2F)

(no "PROSITE Motif" information available for 2M2F)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000310823	1b	ENSE00001490067	chr2:9695917-9695638	280	ADA17_HUMAN	1-33	33	0	-	-
1.2	ENST00000310823	2	ENSE00001001245	chr2:9683414-9683282	133	ADA17_HUMAN	33-77	45	0	-	-
1.3	ENST00000310823	3	ENSE00001001246	chr2:9676957-9676827	131	ADA17_HUMAN	77-121	45	0	-	-
1.4	ENST00000310823	4	ENSE00001001240	chr2:9676051-9675963	89	ADA17_HUMAN	121-150	30	0	-	-
1.5a	ENST00000310823	5a	ENSE00001070593	chr2:9668083-9667915	169	ADA17_HUMAN	151-207	57	0	-	-
1.6	ENST00000310823	6	ENSE00001070592	chr2:9666373-9666240	134	ADA17_HUMAN	207-251	45	0	-	-
1.7	ENST00000310823	7	ENSE00001070603	chr2:9663467-9663378	90	ADA17_HUMAN	252-281	30	0	-	-
1.9	ENST00000310823	9	ENSE00001070599	chr2:9661445-9661332	114	ADA17_HUMAN	282-319	38	0	-	-
1.10	ENST00000310823	10	ENSE00001070595	chr2:9658376-9658232	145	ADA17_HUMAN	320-368	49	0	-	-
1.11	ENST00000310823	11	ENSE00001070597	chr2:9658118-9658030	89	ADA17_HUMAN	368-397	30	0	-	-
1.12	ENST00000310823	12	ENSE00001001237	chr2:9650260-9650108	153	ADA17_HUMAN	398-448	51	0	-	-
1.13	ENST00000310823	13	ENSE00001001234	chr2:9645494-9645295	200	ADA17_HUMAN	449-515	67	0	-	-
1.14	ENST00000310823	14	ENSE00001001242	chr2:9642405-9642302	104	ADA17_HUMAN	515-550	36	0	-	-
1.15	ENST00000310823	15	ENSE00001001233	chr2:9637377-9637243	135	ADA17_HUMAN	550-595	46	1	A:1-15	15
1.16	ENST00000310823	16	ENSE00001001250	chr2:9634896-9634766	131	ADA17_HUMAN	595-638	44	1	A:15-58	44
1.17	ENST00000310823	17	ENSE00001001241	chr2:9633954-9633876	79	ADA17_HUMAN	639-665	27	1	A:59-62	4
1.18	ENST00000310823	18	ENSE00001490117	chr2:9633115-9633027	89	ADA17_HUMAN	665-694	30	0	-	-
1.19	ENST00000310823	19	ENSE00001001249	chr2:9631280-9631230	51	ADA17_HUMAN	695-711	17	0	-	-
1.20	ENST00000310823	20	ENSE00001367317	chr2:9630647-9628615	2033	ADA17_HUMAN	712-824	113	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:62
 aligned with ADA17_HUMAN | P78536 from UniProtKB/Swiss-Prot  Length:824

    Alignment length:62
                                   590       600       610       620       630       640  
          ADA17_HUMAN   581 FCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCE 642
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh.eee....hhhhhh.eee.....eee..............ee....eee...ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.15      -------------------------------------------1.17 Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.16  PDB: A:15-58 UniProt: 595-638    ---- Transcript 1 (2)
                 2m2f A   1 FCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCE  62
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2M2F)

(no "CATH Domain" information available for 2M2F)

(no "Pfam Domain" information available for 2M2F)

NMR Structure(hide GO term definitions)

Chain A (ADA17_HUMAN | P78536)

molecular function
	GO:0005112	Notch binding	Interacting selectively and non-covalently with the Notch (N) protein, a surface receptor.
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0005138	interleukin-6 receptor binding	Interacting selectively and non-covalently with the interleukin-6 receptor.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004222	metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008237	metallopeptidase activity	Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0030183	B cell differentiation	The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0007220	Notch receptor processing	The series of successive proteolytic cleavages of the Notch protein, which result in an active form of the receptor.
	GO:0007219	Notch signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0051088	PMA-inducible membrane protein ectodomain proteolysis	The proteolytic cleavage of transmembrane proteins and release of their ectodomain that occurs after induction by phorbol-12-myristate-13-acetate (PMA), a protein kinase C agonist.
	GO:0033077	T cell differentiation in thymus	The process in which a precursor cell type acquires the specialized features of a T cell via a differentiation pathway dependent upon transit through the thymus.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0033627	cell adhesion mediated by integrin	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via an integrin, a heterodimeric adhesion receptor formed by the non-covalent association of particular alpha and beta subunits.
	GO:0048870	cell motility	Any process involved in the controlled self-propelled movement of a cell that results in translocation of the cell from one place to another.
	GO:0050830	defense response to Gram-positive bacterium	Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0035625	epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway	The process in which an epidermal growth factor-activated receptor is activated via signaling events from a G-protein coupled receptor. This is an example of cross-talk between the EGF and GPCR signaling pathways.
	GO:0002467	germinal center formation	The process in which germinal centers form. A germinal center is a specialized microenvironment formed when activated B cells enter lymphoid follicles. Germinal centers are the foci for B cell proliferation and somatic hypermutation.
	GO:0006509	membrane protein ectodomain proteolysis	The proteolytic cleavage of transmembrane proteins and release of their ectodomain (extracellular domain).
	GO:0031293	membrane protein intracellular domain proteolysis	The proteolytic cleavage of a transmembrane protein leading to the release of an intracellular domain.
	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
	GO:0002446	neutrophil mediated immunity	Any process involved in the carrying out of an immune response by a neutrophil.
	GO:0010820	positive regulation of T cell chemotaxis	Any process that increases the rate, frequency or extent of T cell chemotaxis. T cell chemotaxis is the directed movement of a T cell in response to an external stimulus.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0051272	positive regulation of cellular component movement	Any process that activates or increases the frequency, rate or extent of the movement of a cellular component.
	GO:0032722	positive regulation of chemokine production	Any process that activates or increases the frequency, rate, or extent of chemokine production.
	GO:0031659	positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle	Any process that activates or increases the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity contributing to the G1/S transition of the cell cycle.
	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	Any process that activates or increases the frequency, rate or extent of EGF-activated receptor activity.
	GO:0002690	positive regulation of leukocyte chemotaxis	Any process that activates or increases the frequency, rate, or extent of leukocyte chemotaxis.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of TGF-beta receptor signaling pathway activity.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0033025	regulation of mast cell apoptotic process	Any process that modulates the frequency, rate, or extent of mast cell apoptotic process.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0055099	response to high density lipoprotein particle	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a high density lipoprotein particle stimulus.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0048536	spleen development	The process whose specific outcome is the progression of the spleen over time, from its formation to the mature structure. The spleen is a large vascular lymphatic organ composed of white and red pulp, involved both in hemopoietic and immune system functions.
	GO:0033209	tumor necrosis factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0035313	wound healing, spreading of epidermal cells	The migration of an epidermal cell along or through a wound gap that contributes to the reestablishment of a continuous epidermis.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2m2f)

	Sites
(no "Sites" information available for 2m2f)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m2f)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2m2f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ADA17_HUMAN \| P78536
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.24.86
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ADA17_HUMAN \| P78536
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2M2F)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (5, 5)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (60, 60)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File