|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2M08) |
Sites (0, 0)| (no "Site" information available for 2M08) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2M08) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2M08) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2M08) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2M08) |
Exons (0, 0)| (no "Exon" information available for 2M08) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:93 aligned with A9A2C7_NITMS | A9A2C7 from UniProtKB/TrEMBL Length:92 Alignment length:93 1 | 9 19 29 39 49 59 69 79 89 A9A2C7_NITMS - -MSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRFG 92 SCOP domains --------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 2m08 A 1 GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRFG 93 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2M08) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2M08) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2M08) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (A9A2C7_NITMS | A9A2C7)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|