Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF GPFI C-TERMINAL DOMAIN
 
Authors :  A. Popovic, B. Wu, A. M. Edwards, A. R. Davidson, K. L. Maxwell
Date :  02 May 12  (Deposition) - 25 Jul 12  (Release) - 19 Jun 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Gene Product Fi, Phage Lambda, Dna Packaging, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Popovic, B. Wu, C. H. Arrowsmith, A. M. Edwards, A. R. Davidson, K. L. Maxwell
Structural And Biochemical Characterization Of Phage Lambda Fi Protein (Gpfi) Reveals A Novel Mechanism Of Dna Packagin Chaperone Activity.
J. Biol. Chem. V. 287 32085 2012
PubMed-ID: 22801427  |  Reference-DOI: 10.1074/JBC.M112.378349

(-) Compounds

Molecule 1 - DNA-PACKAGING PROTEIN FI
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN
    GeneFI
    Organism ScientificENTEROBACTERIA PHAGE LAMBDA
    Organism Taxid10710

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LSM)

(-) Sites  (0, 0)

(no "Site" information available for 2LSM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LSM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LSM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LSM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LSM)

(-) Exons   (0, 0)

(no "Exon" information available for 2LSM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:61
 aligned with FI_LAMBD | P03709 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:61
                                    81        91       101       111       121       131 
             FI_LAMBD    72 PDTVILDTSELVTVVALVKLHTDALHATRDEPVAFVLPGTAFRVSAGVAAEMTERGLARMQ 132
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee.......ee......ee.......eeeehhhhhhhhhhh..eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                 2lsm A  72 PDTVILDTSELVTVVALVKLHTDALHATRDEPVAFVLPGTAFRVSAGVAAEMTERGLARMQ 132
                                    81        91       101       111       121       131 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LSM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LSM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LSM)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (FI_LAMBD | P03709)
biological process
    GO:0019072    viral genome packaging    The encapsulation of the viral genome within the capsid.
    GO:0019076    viral release from host cell    The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lsm)
 
  Sites
(no "Sites" information available for 2lsm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lsm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lsm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FI_LAMBD | P03709
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FI_LAMBD | P03709
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LSM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LSM)