|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2LS5) |
Sites (0, 0)| (no "Site" information available for 2LS5) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2LS5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2LS5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2LS5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2LS5) |
Exons (0, 0)| (no "Exon" information available for 2LS5) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:159 aligned with Q8A7E1_BACTN | Q8A7E1 from UniProtKB/TrEMBL Length:200 Alignment length:159 200 59 69 79 89 99 109 119 129 139 149 159 169 179 189 199| Q8A7E1_BACTN 50 DSTGYIVRIGEMAPDFTITLTDGKQVTLSSLRGKVVMLQFTASWCGVCRKEMPFIEKDIWLKHKDNADFALIGIDRDEPLEKVLAFAKSTGVTYPLGLDPGADIFAKYALRDAGITRNVLIDREGKIVKLTRLYNEEEFASLVQQINEMLK-------- - SCOP domains d2ls5a_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2ls5 A 1 MSLGYIVRIGEMAPDFTITLTDGKQVTLSSLRGKVVMLQFTASWCGVCRKEMPFIEKDIWLKHKDNADFALIGIDRDEPLEKVLAFAKSTGVTYPLGLDPGADIFAKYALRDAGITRNVLIDREGKIVKLTRLYNEEEFASLVQQINEMLKEGHHHHHH 159 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2LS5) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2LS5) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q8A7E1_BACTN | Q8A7E1)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|