Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A PUTATIVE PROTEIN DISULFIDE ISOMERASE FROM BACTEROIDES THETAIOTAOMICRON
 
Authors :  R. Harris, A. D. Bandaranayake, R. Banu, J. B. Bonanno, D. A. Calarese, A. Celikgil, S. Chamala, M. K. Chan, R. Chaparro, B. Evans, S. Garforth B. Hillerich, A. Kar, J. Lafleur, S. Lim, J. Love, B. Matikainen, H. Pat R. D. Seidel, B. Smith, M. Stead, M. E. Girvin, S. C. Almo, New York Str Genomics Research Consortium (Nysgrc)
Date :  20 Apr 12  (Deposition) - 09 May 12  (Release) - 09 May 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Structural Genomics, Unknown Function, Thioredoxin-Like, New York Structural Genomics Research Consortium, Nysgrc, Psi-Biology (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Harris, A. D. Bandaranayake, R. Banu, J. B. Bonanno, D. A. Calarese, A. Celikgil, S. Chamala, M. K. Chan, R. Chaparro, B. Evans, S. Garforth A. Gizzi, B. Hillerich, A. Kar, J. Lafleur, S. Lim, J. Love, B. Matikainen, H. Patel, R. D. Seidel, B. Smith, M. Stead, M. E. Girvin, S. C. Almo
Solution Structure Of A Putative Protein Disulfide Isomeras From Bacteroides Thetaiotaomicron
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: MODIFIED PET26
    Fragment: UNP RESIDUES 53-200
    Gene: BT_1583
    Organism Scientific: BACTEROIDES THETAIOTAOMICRON
    Organism Taxid: 226186
    Strain: ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LS5)

(-) Sites  (0, 0)

(no "Site" information available for 2LS5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LS5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LS5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LS5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LS5)

(-) Exons   (0, 0)

(no "Exon" information available for 2LS5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:159
 aligned with Q8A7E1_BACTN | Q8A7E1 from UniProtKB/TrEMBL  Length:200

    Alignment length:159
                                                                                                                                                                                200        
                                    59        69        79        89        99       109       119       129       139       149       159       169       179       189       199|        
         Q8A7E1_BACTN    50 DSTGYIVRIGEMAPDFTITLTDGKQVTLSSLRGKVVMLQFTASWCGVCRKEMPFIEKDIWLKHKDNADFALIGIDRDEPLEKVLAFAKSTGVTYPLGLDPGADIFAKYALRDAGITRNVLIDREGKIVKLTRLYNEEEFASLVQQINEMLK--------   -
               SCOP domains d2ls5a_ A: automated matches                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeee....eeehhhhh..eeeeeee.....hhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhh....eee...hhhhhh.........eeeee.....eeeeee..hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ls5 A   1 MSLGYIVRIGEMAPDFTITLTDGKQVTLSSLRGKVVMLQFTASWCGVCRKEMPFIEKDIWLKHKDNADFALIGIDRDEPLEKVLAFAKSTGVTYPLGLDPGADIFAKYALRDAGITRNVLIDREGKIVKLTRLYNEEEFASLVQQINEMLKEGHHHHHH 159
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LS5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LS5)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q8A7E1_BACTN | Q8A7E1)
molecular function
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ls5)
 
  Sites
(no "Sites" information available for 2ls5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ls5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ls5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8A7E1_BACTN | Q8A7E1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8A7E1_BACTN | Q8A7E1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LS5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LS5)