|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2LLA) |
Sites (0, 0)| (no "Site" information available for 2LLA) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2LLA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2LLA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2LLA) |
Exons (0, 0)| (no "Exon" information available for 2LLA) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:140 aligned with Q95LC7_9MAMM | Q95LC7 from UniProtKB/TrEMBL Length:2473 Alignment length:140 1498 1508 1518 1528 1538 1548 1558 1568 1578 1588 1598 1608 1618 1628 Q95LC7_9MAMM 1489 NVQDNCQVTNPATGYVFDLNSLKRESGYTISDIRKGSIRLGVCGEVKDCGPGIGACFEGTGIKAGKWNQKLSYVDQVLQLVYEDGDPCPANLHLKYKSVISFVCKSDAGPTSQPLLLSMDEHTCTLFFSWHTSLACEQEV 1628 SCOP domains d2llaa_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2lla A 1489 MVQDNCQVTNPATGYVFDLNSLKRESGYTISDIRKGSIRLGVCGEVKDCGPGIGACFEGTGIKAGKWNQKLSYVDQVLQLVYEDGDPCPANLHLKYKSVISFVCKSDAGPTSQPLLLSVDEHTCTLFFSWHTSLACEQEV 1628 1498 1508 1518 1528 1538 1548 1558 1568 1578 1588 1598 1608 1618 1628
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2LLA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2LLA) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (Q95LC7_9MAMM | Q95LC7)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|