2LJB - JenaLib

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:30
 aligned with B4UQM4_9INFB | B4UQM4 from UniProtKB/TrEMBL  Length:109

    Alignment length:33
                                    11        21        31   
          B4UQM4_9INFB    2 LEPFQILSICSFILSALHFIAWTIGHLNQIKRG 34
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..h---hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                  2ljb A 23 SDP---LVVAASIIGILHFIAWTIGHLNQIKRG 52
                              |   | 29        39        49   
                             25  26

Chain A from PDB  Type:PROTEIN  Length:30
 aligned with Q9YP62_9INFA | Q9YP62 from UniProtKB/TrEMBL  Length:97

    Alignment length:40
                                    32        42        52        62
          Q9YP62_9INFA   23 SDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGMKRG 62
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh----------hhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                  2ljb A 23 SDPLVVAASIIGILHFIAWTIGHL----------NQIKRG 52
                                    32        42   |     -    |   52
                                                  46         47

Chain B from PDB  Type:PROTEIN  Length:30
 aligned with B4UQM4_9INFB | B4UQM4 from UniProtKB/TrEMBL  Length:109

    Alignment length:33
                                    11        21        31   
          B4UQM4_9INFB    2 LEPFQILSICSFILSALHFIAWTIGHLNQIKRG 34
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..h---hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                  2ljb B 23 SDP---LVVAASIIGILHFIAWTIGHLNQIKRG 52
                              |   | 29        39        49   
                             25  26

Chain B from PDB  Type:PROTEIN  Length:30
 aligned with Q9YP62_9INFA | Q9YP62 from UniProtKB/TrEMBL  Length:97

    Alignment length:40
                                    32        42        52        62
          Q9YP62_9INFA   23 SDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGMKRG 62
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh----------hh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                  2ljb B 23 SDPLVVAASIIGILHFIAWTIGHL----------NQIKRG 52
                                    32        42   |     -    |   52
                                                  46         47

Chain C from PDB  Type:PROTEIN  Length:30
 aligned with B4UQM4_9INFB | B4UQM4 from UniProtKB/TrEMBL  Length:109

    Alignment length:33
                                    11        21        31   
          B4UQM4_9INFB    2 LEPFQILSICSFILSALHFIAWTIGHLNQIKRG 34
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author .hh---hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                  2ljb C 23 SDP---LVVAASIIGILHFIAWTIGHLNQIKRG 52
                              |   | 29        39        49   
                             25  26

Chain C from PDB  Type:PROTEIN  Length:30
 aligned with Q9YP62_9INFA | Q9YP62 from UniProtKB/TrEMBL  Length:97

    Alignment length:40
                                    32        42        52        62
          Q9YP62_9INFA   23 SDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGMKRG 62
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh----------hh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                  2ljb C 23 SDPLVVAASIIGILHFIAWTIGHL----------NQIKRG 52
                                    32        42   |     -    |   52
                                                  46         47

Chain D from PDB  Type:PROTEIN  Length:30
 aligned with B4UQM4_9INFB | B4UQM4 from UniProtKB/TrEMBL  Length:109

    Alignment length:33
                                    11        21        31   
          B4UQM4_9INFB    2 LEPFQILSICSFILSALHFIAWTIGHLNQIKRG 34
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ..h---hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                  2ljb D 23 SDP---LVVAASIIGILHFIAWTIGHLNQIKRG 52
                              |   | 29        39        49   
                             25  26

Chain D from PDB  Type:PROTEIN  Length:30
 aligned with Q9YP62_9INFA | Q9YP62 from UniProtKB/TrEMBL  Length:97

    Alignment length:40
                                    32        42        52        62
          Q9YP62_9INFA   23 SDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGMKRG 62
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh----------hhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                  2ljb D 23 SDPLVVAASIIGILHFIAWTIGHL----------NQIKRG 52
                                    32        42   |     -    |   52
                                                  46         47

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 16)

NMR Structure(hide GO term definitions)

Chain A,B,C,D (B4UQM4_9INFB | B4UQM4)

biological process
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A,B,C,D (Q9YP62_9INFA | Q9YP62)

molecular function
	GO:0015078	hydrogen ion transmembrane transporter activity	Enables the transfer of hydrogen ions from one side of a membrane to the other.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0039521	suppression by virus of host autophagy	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of autophagy in the host.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ljb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	B4UQM4_9INFB \| B4UQM4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q9YP62_9INFA \| Q9YP62
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments