Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE HUMAN SHWACHMAN-BODIAN-DIAMOND SYNDROME (SBDS) PROTEIN
 
Authors :  C. Hilcenko, S. M. V. Freund, A. J. Warren
Date :  21 Feb 11  (Deposition) - 11 May 11  (Release) - 11 May 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. J. Finch, C. Hilcenko, N. Basse, L. F. Drynan, B. Goyenechea, T. F. Menne, A. Gonzalez Fernandez, P. Simpson, C. S. D'Santos, M. J. Arends, J. Donadieu, C. Bellanne-Chantelot, M. Costanzo, C. Boone, A. N. Mckenzie, S. M. Freund, A. J. Warren
Uncoupling Of Gtp Hydrolysis From Eif6 Release On The Ribosome Causes Shwachman-Diamond Syndrome.
Genes Dev. V. 25 917 2011
PubMed-ID: 21536732  |  Reference-DOI: 10.1101/GAD.623011

(-) Compounds

Molecule 1 - RIBOSOME MATURATION PROTEIN SBDS
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: C41 (DE3)
    Expression System Taxid: 562
    Expression System Vector: PSBDS
    Gene: CGI-97, SBDS
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: SHWACHMAN-BODIAN-DIAMOND SYNDROME PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L9N)

(-) Sites  (0, 0)

(no "Site" information available for 2L9N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2L9N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L9N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

NMR Structure (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_015390N8KSBDS_HUMANDisease (SDS)28942099AN8K
2UniProtVAR_071673K33TSBDS_HUMANDisease (SDS)  ---AK33T
3UniProtVAR_015391E44GSBDS_HUMANDisease (SDS)  ---AE44G
4UniProtVAR_015392K67ESBDS_HUMANDisease (SDS)  ---AK67E
5UniProtVAR_015393I87SSBDS_HUMANDisease (SDS)  ---AI87S
6UniProtVAR_015394R126TSBDS_HUMANDisease (SDS)113993995AR126T
7UniProtVAR_015395R169CSBDS_HUMANDisease (SDS)113993996AR169C
8UniProtVAR_015396I212TSBDS_HUMANDisease (SDS)79344818AI212T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_015390N8KSBDS_HUMANDisease (SDS)28942099AN8K
2UniProtVAR_071673K33TSBDS_HUMANDisease (SDS)  ---AK33T
3UniProtVAR_015391E44GSBDS_HUMANDisease (SDS)  ---AE44G
4UniProtVAR_015392K67ESBDS_HUMANDisease (SDS)  ---AK67E
5UniProtVAR_015393I87SSBDS_HUMANDisease (SDS)  ---AI87S
6UniProtVAR_015394R126TSBDS_HUMANDisease (SDS)113993995AR126T
7UniProtVAR_015395R169CSBDS_HUMANDisease (SDS)113993996AR169C
8UniProtVAR_015396I212TSBDS_HUMANDisease (SDS)79344818AI212T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UPF0023PS01267 Uncharacterized protein family UPF0023 signature.SBDS_HUMAN44-63  1A:44-63
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UPF0023PS01267 Uncharacterized protein family UPF0023 signature.SBDS_HUMAN44-63  1A:44-63

(-) Exons   (0, 0)

(no "Exon" information available for 2L9N)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:250
 aligned with SBDS_HUMAN | Q9Y3A5 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
           SBDS_HUMAN     1 MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE 250
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------SBDS-2l9nA02 A:13-103                                                                      --SBDS_C-2l9nA01 A:106-227                                                                                                  ----------------------- Pfam domains
         Sec.struct. author ...............eeeeeee..eeeeeeehhhhhhhhhhh...hhhhhh...............hhhhhhhhhh..hhhhhhhhhhhh.eee.hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh.....eeeeeeee..hhhhhhhhhhhhhheeeeeee.....eeeeeeee..hhhhhhhhhhhhhh...eeee............. Sec.struct. author
                 SAPs(SNPs) -------K------------------------T----------G----------------------E-------------------S--------------------------------------T------------------------------------------C------------------------------------------T-------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------UPF0023  PDB: A:44-6------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2l9n A   1 MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE 250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2L9N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L9N)

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: EF-G_C (20)

(-) Gene Ontology  (20, 20)

NMR Structure(hide GO term definitions)
Chain A   (SBDS_HUMAN | Q9Y3A5)
molecular function
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0043022    ribosome binding    Interacting selectively and non-covalently with any part of a ribosome.
biological process
    GO:0048539    bone marrow development    The process whose specific outcome is the progression of the bone marrow over time, from its formation to the mature structure.
    GO:0030282    bone mineralization    The deposition of hydroxyapatite, a form of calcium phosphate with the formula Ca10(PO4)6(OH)2, in bone tissue.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0001833    inner cell mass cell proliferation    The proliferation of cells in the inner cell mass.
    GO:0030595    leukocyte chemotaxis    The movement of a leukocyte in response to an external stimulus.
    GO:0042256    mature ribosome assembly    The aggregation, arrangement and bonding together of the large and small ribosomal subunits into a functional ribosome.
    GO:0007052    mitotic spindle organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle during a mitotic cell cycle.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
    GO:0042254    ribosome biogenesis    A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l9n)
 
  Sites
(no "Sites" information available for 2l9n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l9n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l9n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SBDS_HUMAN | Q9Y3A5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  260400
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SBDS_HUMAN | Q9Y3A5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SBDS_HUMAN | Q9Y3A5: 2kdo 5an9 5anb 5anc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2L9N)