Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE PHYCOBILISOME LINKER POLYPEPTIDE DOMAIN OF CPCC (20-153) FROM THERMOSYNECHOCOCCUS ELONGATUS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET TER219A
 
Authors :  T. A. Ramelot, Y. Yang, J. R. Cort, D. Lee, C. Ciccosanti, K. Hamilton, T. R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy, Northeast Str Genomics Consortium (Nesg)
Date :  26 Jan 11  (Deposition) - 09 Feb 11  (Release) - 09 Feb 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Nesg, Structural Genomics, Northeast Structural Genomics Consortium, Photosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. A. Ramelot, Y. Yang, J. R. Cort, D. Lee, C. Ciccosanti, K. Hamilton, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy
Solution Nmr Structure Of The Phycobilisome Linker Polypeptide Domain Of Cpcc (20-153) From Thermosynechococcu Elongatus, Northeast Structural Genomics Consortium Target Ter219A
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHYCOBILISOME 32.1 KDA LINKER POLYPEPTIDE, PHYCOCYANIN- ASSOCIATED, ROD
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21 (DE3) + MAGIC
    Expression System Taxid: 469008
    Expression System Vector: PET21-23C
    Fragment: SEQUENCE DATABASE RESIDUES 20-153
    Gene: CPCC, TLR1959
    Organism Scientific: THERMOSYNECHOCOCCUS ELONGATUS
    Organism Taxid: 197221
    Strain: BP-1

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L8V)

(-) Sites  (0, 0)

(no "Site" information available for 2L8V)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2L8V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L8V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2L8V)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2L8V)

(-) Exons   (0, 0)

(no "Exon" information available for 2L8V)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with PYR1_THEEB | P50034 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:143
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158   
           PYR1_THEEB    19 PPVELRANWSEEDLETVIRAVYRQVLGNDYVMASERLVSAESLLRNGKITVREFVRAVAKSELYKEKFLYGNFQTRVIELNYKHLLGRAPYDESEVIFHLDLYENEGFDADIDSYIDSPEYTNSFGDWVVPYYRGFNTQPGQK 161
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----PBS_linker_poly-2l8vA01 A:5-135                                                                                                    -------- Pfam domains
         Sec.struct. author ..ee.....hhhhhhhhhhhhh..............hhhhhhhhhh...hhhhhhhhhhh............hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2l8v A   1 MPVELRANWSEEDLETVIRAVYRQVLGNDYVMASERLVSAESLLRNGKITVREFVRAVAKSELYKEKFLYGNFQTRVIELNYKHLLGRAPYDESEVIFHLDLYENEGFDADIDSYIDSPEYTNSFGDWVVPYYRGLEHHHHHH 143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2L8V)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L8V)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: PBS_linker_poly] (8)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (PYR1_THEEB | P50034)
biological process
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l8v)
 
  Sites
(no "Sites" information available for 2l8v)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l8v)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l8v
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PYR1_THEEB | P50034
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PYR1_THEEB | P50034
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2L8V)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2L8V)