|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2L28) |
Sites (0, 0)| (no "Site" information available for 2L28) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2L28) |
Cis Peptide Bonds (2, 50)
NMR Structure
|
|||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2L28) |
PROSITE Motifs (1, 1)| NMR Structure (1, 1) NMR Structure * (1, 1) |
Exons (0, 0)| (no "Exon" information available for 2L28) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:162 aligned with DYR_LACCA | P00381 from UniProtKB/Swiss-Prot Length:163 Alignment length:162 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 DYR_LACCA 2 TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA 163 SCOP domains d2l28a_ A: Dihydrofolate reductase, prokaryotic type SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains DHFR_1-2l28A01 A:1-160 -- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -----------DHFR_1 PDB: A:12-34 -------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2l28 A 1 TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA 162 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2L28) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (DYR_LACCA | P00381)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|