|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2L0C) |
Sites (0, 0)| (no "Site" information available for 2L0C) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2L0C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2L0C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2L0C) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2L0C) |
Exons (0, 0)| (no "Exon" information available for 2L0C) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:97 aligned with Q8Z254_SALTI | Q8Z254 from UniProtKB/TrEMBL Length:123 Alignment length:97 123 44 54 64 74 84 94 104 114 |- Q8Z254_SALTI 35 AAPLQQKQVVVSNKREKPVNDRRSRQQEVSPAGTSMRYEASFKPLNGGLEKTFRLQAQQYHALTVGDQGTLSYKGTRFVGFVSRTPDNE-------- - SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains -DUF2500-2l0cA01 A:2-83 -------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 2l0c A 1 MAPLQQKQVVVSNKREKPVNDRRSRQQEVSPAGTSMRYEASFKPLNGGLEKTFRLQAQQYHALTVGDQGTLSYKGTRFVGFVSRTPDNELEHHHHHH 97 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2L0C) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2L0C) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q8Z254_SALTI | Q8Z254)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|