Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF A3DHT5 FROM CLOSTRIDIUM THERMOCELLUM, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CMR116
 
Authors :  J. L. Mills, A. Eletsky, H. Lee, H. Janjua, C. Ciccosanti, R. Wang, B. Ros T. B. Acton, R. Xiao, J. K. Everett, J. H. Prestegard, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Date :  25 Jun 10  (Deposition) - 25 Aug 10  (Release) - 15 Feb 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Psi-2, Protein Structure Initiative, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. L. Mills, A. Eletsky, H. Lee, H. Janjua, C. Ciccosanti, R. Wang, B. Rost, T. B. Acton, R. Xiao, J. K. Everett, J. H. Prestegard, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Northeast Structural Genomics Consortium Target Cmr116
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)PMGK
    Expression System Taxid: 562
    Expression System Vector: PET 21-23C
    Fragment: SEQUENCE DATABASE RESIDUES 38-159
    Gene: CTHE_2312
    Organism Scientific: CLOSTRIDIUM THERMOCELLUM
    Organism Taxid: 203119
    Strain: ATCC 27405 / DSM 1237

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KZX)

(-) Sites  (0, 0)

(no "Site" information available for 2KZX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KZX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KZX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KZX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KZX)

(-) Exons   (0, 0)

(no "Exon" information available for 2KZX)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:131
 aligned with A3DHT5_CLOTH | A3DHT5 from UniProtKB/TrEMBL  Length:159

    Alignment length:131
                                                                                                                                                    159        
                                    46        56        66        76        86        96       106       116       126       136       146       156  |      - 
         A3DHT5_CLOTH    37 YKDGTYYAEADDFDESGWKDTVTIEVKNGKIVSVDWNAINKDGGDDKDTLSRNGGYKMVEYGGAQAEWHEQAEKVEAYLVEKQDPTDIKYKDNDGHTDAISGATIKVKKFFDLAQKALKDAEK--------   -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee........eeeeeeeeee..eeeeeeeeeee.....hhhhhhhhh................hhhhhhhhhhhhh.......................hhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kzx A   1 MKDGTYYAEADDFDESGWKDTVTIEVKNGKIVSVDWNAINKDGGDDKDTLSRNGGYKMVEYGGAQAEWHEQAEKVEAYLVEKQDPTDIKYKDNDGHTDAISGATIKVKKFFDLAQKALKDAEKLEHHHHHH 131
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KZX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KZX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2KZX)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (A3DHT5_CLOTH | A3DHT5)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kzx)
 
  Sites
(no "Sites" information available for 2kzx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kzx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kzx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A3DHT5_CLOTH | A3DHT5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A3DHT5_CLOTH | A3DHT5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KZX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KZX)