|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KZF) |
Sites (0, 0)| (no "Site" information available for 2KZF) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KZF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KZF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KZF) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KZF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:106 aligned with RBFA_THEMA | Q9WZV9 from UniProtKB/Swiss-Prot Length:131 Alignment length:106 1 | 9 19 29 39 49 59 69 79 89 99 RBFA_THEMA - -MNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVK 105 SCOP domains d2kzfa_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------RBFA-2kzfA01 A:7-106 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------RBFA PDB: A:77-98 -------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2kzf A 1 GMNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVK 106 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KZF) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (RBFA_THEMA | Q9WZV9)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|