2KY4 - JenaLib

Title :   SOLUTION NMR STRUCTURE OF THE PBS LINKER DOMAIN OF PHYCOBILISOME LINKER POLYPEPTIDE FROM ANABAENA SP. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET NSR123E

Authors :   Y. He, A. Eletsky, J. L. Mills, D. Lee, C. Ciccosanti, K. Hamilton, T. B. A R. Xiao, J. K. Everett, H. Lee, J. H. Prestegard, G. T. Montelione, T. Sz Northeast Structural Genomics Consortium (Nesg)

Date :   14 May 10 (Deposition) - 14 Jul 10 (Release) - 14 Jul 10 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (14x)

Keywords :   Nesg, Psi, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, Photosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. He, A. Eletsky, J. L. Mills, D. Lee, C. Ciccosanti, K. Hamilton, T. B. Acton, R. Xiao, J. K. Everett, H. Lee, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of The Pbs Linker Domain Of Phycobilisome Linker Polypeptide From Anabaena Sp. Northeas Structural Genomics Consortium Target Nsr123E
To Be Published
PubMed: search

Compounds

Molecule 1 - PHYCOBILISOME LINKER POLYPEPTIDE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)+ MAGIC
	Expression System Taxid	:	469008
	Expression System Vector	:	PET 21-23C
	Fragment	:	PBS-LINKER 3 DOMAIN RESIDUES 727-867
	Gene	:	ALR0020, APCE
	Organism Scientific	:	NOSTOC SP.
	Organism Taxid	:	103690
	Strain	:	PCC 7120
	Synonym	:	ANCHOR POLYPEPTIDE, PBS-ANCHOR PROTEIN

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:149
 aligned with APCE_NOSS1 | P80559 from UniProtKB/Swiss-Prot  Length:1132

    Alignment length:149
                                   735       745       755       765       775       785       795       805       815       825       835       845       855       865         
           APCE_NOSS1   726 TKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEIRKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLPAANFPN 874
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------PBS_linker_poly-2ky4A01 A:9-139                                                                                                    ---------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ky4 A   1 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEIRKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A (APCE_NOSS1 | P80559)

molecular function
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0030089	phycobilisome	Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ky4)

	Sites
(no "Sites" information available for 2ky4)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ky4)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ky4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	APCE_NOSS1 \| P80559
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	APCE_NOSS1 \| P80559
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description