|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KW6) |
Sites (0, 0)| (no "Site" information available for 2KW6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KW6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KW6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KW6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KW6) |
Exons (0, 0)| (no "Exon" information available for 2KW6) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:65 aligned with CDKA1_HUMAN | O14519 from UniProtKB/Swiss-Prot Length:115 Alignment length:65 60 70 80 90 100 110 CDKA1_HUMAN 51 QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2kw6 A 51 MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:65 aligned with CDKA1_HUMAN | O14519 from UniProtKB/Swiss-Prot Length:115 Alignment length:65 60 70 80 90 100 110 CDKA1_HUMAN 51 QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains (1) ----------CDK2AP-2kw6B01 B:261-315 Pfam domains (1) Pfam domains (2) ----------CDK2AP-2kw6B02 B:261-315 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2kw6 B 251 MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 315 260 270 280 290 300 310
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KW6) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KW6) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A,B (CDKA1_HUMAN | O14519)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|