![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2KW6) |
(no "Site" information available for 2KW6) |
(no "SS Bond" information available for 2KW6) |
(no "Cis Peptide Bond" information available for 2KW6) |
(no "SAP(SNP)/Variant" information available for 2KW6) |
(no "PROSITE Motif" information available for 2KW6) |
(no "Exon" information available for 2KW6) |
NMR StructureChain A from PDB Type:PROTEIN Length:65 aligned with CDKA1_HUMAN | O14519 from UniProtKB/Swiss-Prot Length:115 Alignment length:65 60 70 80 90 100 110 CDKA1_HUMAN 51 QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2kw6 A 51 MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:65 aligned with CDKA1_HUMAN | O14519 from UniProtKB/Swiss-Prot Length:115 Alignment length:65 60 70 80 90 100 110 CDKA1_HUMAN 51 QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains (1) ----------CDK2AP-2kw6B01 B:261-315 Pfam domains (1) Pfam domains (2) ----------CDK2AP-2kw6B02 B:261-315 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2kw6 B 251 MGHHHHHHSHSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 315 260 270 280 290 300 310
|
(no "SCOP Domain" information available for 2KW6) |
(no "CATH Domain" information available for 2KW6) |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (CDKA1_HUMAN | O14519)
|
|
|
|
|
|
|