Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE PROTEIN NP_415897.1
 
Authors :  P. Serrano, K. Jaudzems, M. Geralt, R. Horst, K. Wuthrich, I. A. Wilson, Center For Structural Genomics (Jcsg)
Date :  06 Feb 10  (Deposition) - 23 Feb 10  (Release) - 20 Mar 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
NMR Structure *:  A  (1x)
Keywords :  Np_415897. 1, Jcsg, Stress Response, Structural Genomics, Protein Structure Initiative, Joint Center For Structural Genomics, Psi, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Serrano, K. Jaudzems, M. Geralt, R. Horst, I. A. Wilson, K. Wuthrich
Nmr Structure Of The Protein Np_415897. 1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HEAT SHOCK PROTEIN HSLJ
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 469008
    Expression System Variant: (DE3)
    Expression System Vector: PET25B
    Fragment: SEQUENCE DATABASE RESIDUES 25-140
    Gene: HSLJ, YDBI, B1379, JW1374
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 83333
    Strain: K12

 Structural Features

(-) Chains, Units

  1
NMR Structure (19x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KTS)

(-) Sites  (0, 0)

(no "Site" information available for 2KTS)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:44 -A:70

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KTS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KTS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KTS)

(-) Exons   (0, 0)

(no "Exon" information available for 2KTS)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:117
 aligned with HSLJ_ECOLI | P52644 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:117
                                    33        43        53        63        73        83        93       103       113       123       133       
           HSLJ_ECOLI    24 AVTPEQLQHHRFVLESVNGKPVTSDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTANQLTLATAKQTLTYKLADLMN 140
               SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----META-2ktsA01 A:6-103                                                                              -------------- Pfam domains
         Sec.struct. author ...........eeeeee............eeeeehhheeee.....eee.......ee....eee......hhhhhhhhhhhhhhhhhheeeee...eeeee....eeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------- Transcript
                 2kts A   1 MVTPEQLQHHRFVLESVNGKPVTSDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTANQLTLATAKQTLTYKLADLMN 117
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KTS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KTS)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Calycin (163)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (HSLJ_ECOLI | P52644)
biological process
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kts)
 
  Sites
(no "Sites" information available for 2kts)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kts)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kts
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HSLJ_ECOLI | P52644
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HSLJ_ECOLI | P52644
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KTS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KTS)