Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION STRUCTURE OF BACILLUS SUBTILIS, YNDB, NORTHEAST STRUCTURAL GENOMICS CONSORITUM TARGET SR211
 
Authors :  K. A. Mercier, G. A. Mueller, R. Powers, T. B. Acton, M. Ciano, C. Ho, J. Lu B. Rost, R. Rossi, G. T. Montelione, R. Xiao, Northeast Structural G Consortium (Nesg)
Date :  29 Jan 10  (Deposition) - 16 Jun 10  (Release) - 25 Aug 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (18x)
NMR Structure *:  A  (1x)
Keywords :  Ahsa1, Lipid Binding, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Powers, J. Stark, K. A. Mercier, G. Mueller, T. Acton, R. Xiao, G. T. Montelione
Solution Structure And Function Of Yndb, An Ahsa1 Protein From Bacillus Subtilis
Proteins V. 3 191 2010
PubMed-ID: 19888688  |  Reference-DOI: 22840

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN YNDB
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: MVK
    Gene: YNDB, BSU17730
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423

 Structural Features

(-) Chains, Units

  1
NMR Structure (18x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KTE)

(-) Sites  (0, 0)

(no "Site" information available for 2KTE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KTE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KTE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KTE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KTE)

(-) Exons   (0, 0)

(no "Exon" information available for 2KTE)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:152
 aligned with YNDB_BACSU | O31806 from UniProtKB/Swiss-Prot  Length:144

    Alignment length:152
                                                                                                                                                                         144        
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   |     -  
           YNDB_BACSU     1 MAQNNENALPDITKSITLEAPIQKVWETVSTSEGIAKWFMPNDFQLKEGQEFHLQSPFGPSPCKVLAVQAPTELSFEWDTEGWVVTFQLEDLGEKTGFTLIHSGWKEPNEVIGKANEKSSVVRGKMDGGWTGIVNERLRKAVEE--------   -
               SCOP domains d2ktea_ A: automated matches                                                                                                                             SCOP domains
               CATH domains 2kteA00 A:1-152  [code=3.30.530.20, no name defined]                                                                                                     CATH domains
               Pfam domains ------------------AHSA1-2kteA01 A:19-143                                                                                                       --------- Pfam domains
         Sec.struct. author ...........eeeeeee..hhhhhhhhh.hhhhhhh.........................eeeeeee...eeeeee....eeeeeeeee....eeeeeeeee..............hhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kte A   1 MAQNNENALPDITKSITLEAPIQKVWETVSTSEGIAKWFMPNDFQLKEGQEFHLQSPFGPSPCKVLAVQAPTELSFEWDTEGWVVTFQLEDLGEKTGFTLIHSGWKEPNEVIGKANEKSSVVRGKMDGGWTGIVNERLRKAVEELEHHHHHH 152
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Bet_V_1_like (93)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (YNDB_BACSU | O31806)
biological process
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kte)
 
  Sites
(no "Sites" information available for 2kte)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kte)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kte
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YNDB_BACSU | O31806
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  YNDB_BACSU | O31806
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        YNDB_BACSU | O31806: 2kew

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KTE)