Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF A DOMAIN OF PROTEIN A6KY75 FROM BACTEROIDES VULGATUS, NORTHEAST STRUCTURAL GENOMICS TARGET BVR106A
 
Authors :  J. L. Mills, D. K. Sukumaran, B. Sathyamoorthy, R. L. Belote, C. Ciccosa K. Hamilton, T. B. Acton, R. Xiao, G. V. T. Swapna, J. K. Everett, G. T. Mo T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Date :  26 Jan 10  (Deposition) - 16 Jun 10  (Release) - 07 Mar 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Psi, Nesg, Gft Nmr, Atp-Binding, Nucleotide-Binding, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. L. Mills, D. K. Sukumaran, B. Sathyamoorthy, R. L. Belote, C. Ciccosanti, K. Hamilton, T. B. Acton, R. Xiao, G. V. T. Swapna, J. K. Everett, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of A Domain Of Protein A6Ky75 From Bacteroides Vulgatus, Northeast Structural Genomics Target Bvr106A
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE HELICASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid469008
    Expression System VectorPET 21-23C
    FragmentSEQUENCE DATABASE RESIDUES 627-693
    GeneBVU_0683, BVU_1551
    Organism ScientificBACTEROIDES VULGATUS
    Organism Taxid435590
    StrainATCC 8482 / DSM 1447 / NCTC 11154

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KTA)

(-) Sites  (0, 0)

(no "Site" information available for 2KTA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KTA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KTA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KTA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KTA)

(-) Exons   (0, 0)

(no "Exon" information available for 2KTA)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:74
 aligned with A6KY75_BACV8 | A6KY75 from UniProtKB/TrEMBL  Length:753

    Alignment length:83
                                   635       645       655       665       675       685       695       705   
         A6KY75_BACV8   626 WNQNLQGEWMKNYEELKSFVRKYRRFPKSTEGNLGGWCHTQRKMRKQGKLPNDRRLLLDKIGFVWSAEQVWQGNFEQLCLFHN 708
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains -HA-2ktaA01 A:2-64                                              ------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..........---------.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                 2kta A   1 MNQNLQGEWMKNYEELKSFVRKYRRFPKSTEGNLGGWCHTQRKMRKQGKLPNDRRLLLDKIGFVWSLEHHHH---------HH  74
                                    10        20        30        40        50        60        70 |       - | 
                                                                                                  72        73 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KTA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KTA)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (A6KY75_BACV8 | A6KY75)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kta)
 
  Sites
(no "Sites" information available for 2kta)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kta)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kta
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A6KY75_BACV8 | A6KY75
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A6KY75_BACV8 | A6KY75
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KTA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KTA)