Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF PROBABLE 30S RIBOSOMAL PROTEIN PSRP-3 (YCF65-LIKE PROTEIN) FROM SYNECHOCYSTIS SP. (STRAIN PCC 6803), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET TARGET SGR46
 
Authors :  G. Liu, J. Janjua, R. Xiao, B. Mao, W. A. Buchwald, C. Ciccosanti, R. L. Belote, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, Northeast Structural Genomics Consortium (Nesg)
Date :  22 Jan 10  (Deposition) - 16 Feb 10  (Release) - 16 Feb 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Target Sgr46, Psi-2, Protein Structure Initiative, Ribonucleoprotein, Ribosomal Protein, Psrp-3, Ycf65-Like Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Liu, J. Janjua, R. Xiao, W. A. Buchwald, C. Ciccosanti, R. L. Belote, E. K. Everett, R. Nair, A. B. Acton, B. Rost, G. T. Montelione
Solution Nmr Structure Of Probable 30S Ribosomal Protein Psrp-3 (Ycf65-Like Protein) From Synechocystis Sp. (Pcc 6803), Northeast Structural Genomics Consortium Target Target Sgr46
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROBABLE 30S RIBOSOMAL PROTEIN PSRP-3
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid469008
    Expression System VectorPLASMID
    Expression System Vector TypePET 21-23C
    FragmentSEQUENCE DATABASE RESIDUES 6-112
    GeneSLR0923
    Organism ScientificSYNECHOCYSTIS SP.
    Organism Taxid1148
    StrainPCC 6803
    SynonymYCF65-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KT9)

(-) Sites  (0, 0)

(no "Site" information available for 2KT9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KT9)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Trp A:42 -Pro A:43

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KT9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KT9)

(-) Exons   (0, 0)

(no "Exon" information available for 2KT9)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with RRP3_SYNY3 | Q55385 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:116
                                                                                                                                     112        
                                    14        24        34        44        54        64        74        84        94       104       | -      
           RRP3_SYNY3     5 EAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSN--------   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee....eeeeeeeee..eeee....eee...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.....eeee.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 2kt9 A   1 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH 116
                                    10        20        30        40        50        60        70        80        90       100       110      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KT9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KT9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2KT9)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (RRP3_SYNY3 | Q55385)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kt9)
 
  Sites
(no "Sites" information available for 2kt9)
 
  Cis Peptide Bonds
    Trp A:42 - Pro A:43   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kt9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RRP3_SYNY3 | Q55385
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RRP3_SYNY3 | Q55385
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KT9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KT9)