|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KT9) |
Sites (0, 0)| (no "Site" information available for 2KT9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KT9) |
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KT9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KT9) |
Exons (0, 0)| (no "Exon" information available for 2KT9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:116 aligned with RRP3_SYNY3 | Q55385 from UniProtKB/Swiss-Prot Length:112 Alignment length:116 112 14 24 34 44 54 64 74 84 94 104 | - RRP3_SYNY3 5 EAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSN-------- - SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 2kt9 A 1 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH 116 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KT9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KT9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2KT9) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (RRP3_SYNY3 | Q55385)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|