|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KSN) |
Sites (0, 0)| (no "Site" information available for 2KSN) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KSN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KSN) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KSN) |
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:128 aligned with UBTD2_HUMAN | Q8WUN7 from UniProtKB/Swiss-Prot Length:234 Alignment length:128 23 33 43 53 63 73 83 93 103 113 123 133 UBTD2_HUMAN 14 SLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDI 141 SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------I------------ SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.1 ------------------------------------------------------------------------------Exon 1.3 PDB: A:103-141 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ----------Exon 1.2 PDB: A:24-103 UniProt: 24-103 -------------------------------------- Transcript 1 (2) 2ksn A 14 SLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDI 141 23 33 43 53 63 73 83 93 103 113 123 133
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KSN) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KSN) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2KSN) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (UBTD2_HUMAN | Q8WUN7)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|