Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE PCP_RED DOMAIN OF LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE SUBUNIT B FROM CHLOROBIUM TEPIDUM. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CTR69A
 
Authors :  Y. He, A. Eletsky, D. Lee, C. Ciccosanti, H. Janjua, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, T. Szyperski, Northeast Structural Consortium (Nesg)
Date :  22 Dec 09  (Deposition) - 16 Feb 10  (Release) - 20 Jun 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Nesg, Psi, Bchb, Bacteriochlorophyll Biosynthesis, Chlorophyll Biosynthesis, Oxidoreductase, Photosynthesis, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. He, A. Eletsky, D. Lee, C. Ciccosanti, H. Janjua, T. B. Acton, R. Xiao J. K. Everett, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of The Pcp_red Domain Of Light-Independent Protochlorophyllide Reductase Subunit B From Chlorobium Tepidum. Northeast Structural Genomics Consortium Target Ctr69A
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE SUBUNIT B
    ChainsA
    EC Number1.18.-.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid562
    Expression System VectorPET 21-23C
    FragmentRESIDUES 484-537
    GeneBCHB, CT2151
    Organism ScientificCHLOROBACULUM TEPIDUM
    Organism Taxid1097
    StrainTLS
    SynonymLI-POR SUBUNIT B, DPOR SUBUNIT B

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KRU)

(-) Sites  (0, 0)

(no "Site" information available for 2KRU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KRU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KRU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KRU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KRU)

(-) Exons   (0, 0)

(no "Exon" information available for 2KRU)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:63
 aligned with BCHB_CHLTE | Q9F715 from UniProtKB/Swiss-Prot  Length:537

    Alignment length:63
                                                                                537        
                                   492       502       512       522       532    |    -   
           BCHB_CHLTE   483 TGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGG--------   -
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains -----PCP_red-2kruA01 A:6-50                       ------------- Pfam domains
         Sec.struct. author ....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------- Transcript
                 2kru A   1 MGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGGLEHHHHHH  63
                                    10        20        30        40        50        60   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KRU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KRU)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (15, 15)

NMR Structure(hide GO term definitions)
Chain A   (BCHB_CHLTE | Q9F715)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016730    oxidoreductase activity, acting on iron-sulfur proteins as donors    Catalysis of an oxidation-reduction (redox) reaction in which an iron-sulfur protein acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0016636    oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces an iron-sulfur protein.
biological process
    GO:0030494    bacteriochlorophyll biosynthetic process    The chemical reactions and pathways resulting in the formation of a bacteriochlorophyll, any of the chlorophylls of photosynthetic bacteria. They differ structurally from the chlorophylls of higher plants.
    GO:0015995    chlorophyll biosynthetic process    The chemical reactions and pathways resulting in the formation of chlorophyll, any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment, from less complex precursors.
    GO:0036070    light-independent bacteriochlorophyll biosynthetic process    The chemical reactions and pathways resulting in the formation of a bacteriochlorophyll, which occur in the absence of light. Bacteriochlorophylls are any of the chlorophylls of photosynthetic bacteria; they differ structurally from the chlorophylls of higher plants.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019685    photosynthesis, dark reaction    A complex cycle of enzyme-mediated reactions which catalyzes the reduction of carbon dioxide to sugar. As well as carbon dioxide the cycle requires reducing power in the form of reduced nicotinamide adenine dinucleotide phosphate (NADP) and chemical energy in the form of adenosine triphosphate (ATP). The reduced NADP (NADPH) and ATP are produced by the 'light' reactions.
    GO:0046148    pigment biosynthetic process    The chemical reactions and pathways resulting in the formation of a pigment, any general or particular coloring matter in living organisms, e.g. melanin.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kru)
 
  Sites
(no "Sites" information available for 2kru)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kru)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kru
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BCHB_CHLTE | Q9F715
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.18.-.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BCHB_CHLTE | Q9F715
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KRU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KRU)