|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KQ8) |
Sites (0, 0)| (no "Site" information available for 2KQ8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KQ8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KQ8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KQ8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KQ8) |
Exons (0, 0)| (no "Exon" information available for 2KQ8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:70 aligned with Q6HB52_BACHK | Q6HB52 from UniProtKB/TrEMBL Length:580 Alignment length:76 378 388 398 408 418 428 438 Q6HB52_BACHK 369 AIGDYYINASALNVRSGEGTNYRIIGALPQGQKVQVISENSGWSKINYNGQTGYIGTRYLSKTPVGGAVDNNKPNN 444 SCOP domains ---------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------- CATH domains Pfam domains ---------SH3_3-2kq8A01 A:10-61 --------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------- Transcript 2kq8 A 1 MIGDYYINASALNVRSGEGTNYRIIGALPQGQKVQVISENSGWSKINYNGQTGYIGTRYLSK------LEHHHHHH 70 10 20 30 40 50 60 | 64 62 63
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KQ8) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KQ8) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q6HB52_BACHK | Q6HB52)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|