Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HELICAL HAIRPIN STRUCTURE OF PARDAXIN IN LIPOPOLYSACCHARIDE MICELLES: STUDIED BY NMR SPECTROSCOPY
 
Authors :  A. Bhunia, S. Bhattacharjya, A. Ramamoorthy
Date :  03 Sep 09  (Deposition) - 15 Dec 09  (Release) - 09 Feb 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Pardaxin, Pa4, Lps, Trnoe, Antimicrobial Peptide, Std Nmr, Ion Transport, Porin, Secreted, Toxin, Transmembrane, Transport, Antimicrobial Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Bhunia, P. N. Domadia, J. Torres, K. J. Hallock, A. Ramamoorthy, S. Bhattacharjya
Nmr Structure Of Pardaxin, A Pore-Forming Antimicrobial Peptide, In Lipopolysaccharide Micelles: Mechanism Of Outer Membrane Permeabilization
J. Biol. Chem. V. 285 3883 2010
PubMed-ID: 19959835  |  Reference-DOI: 10.1074/JBC.M109.065672

(-) Compounds

Molecule 1 - PARDAXIN P-4
    Chains: A
    Engineered: YES
    Organism Common: RED SEA MOSES SOLE
    Organism Scientific: PARDACHIRUS MARMORATUS
    Organism Taxid: 31087
    Other Details: STANDARD F-MOC SOLID PHASE PEPTIDE SYNTHESIS
    Synonym: PARDAXIN PA4, PARDAXIN P1A
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KNS)

(-) Sites  (0, 0)

(no "Site" information available for 2KNS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KNS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KNS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KNS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KNS)

(-) Exons   (0, 0)

(no "Exon" information available for 2KNS)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:33
 aligned with PAP4_PARMA | P81861 from UniProtKB/Swiss-Prot  Length:33

    Alignment length:33
                                    10        20        30   
            PAP4_PARMA    1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE 33
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains Pardaxin-2knsA01 A:1-33           Pfam domains
         Sec.struct. author ...hhhhhhhhh..hhhhhhhhhhhhh.hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                  2kns A  1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE 33
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KNS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KNS)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Pardaxin] (2)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (PAP4_PARMA | P81861)
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0044218    other organism cell membrane    The cell membrane of a secondary organism with which the first organism is interacting.
    GO:0044279    other organism membrane    A membrane of a secondary organism with which the first organism is interacting.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kns)
 
  Sites
(no "Sites" information available for 2kns)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kns)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kns
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PAP4_PARMA | P81861
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PAP4_PARMA | P81861
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PAP4_PARMA | P81861: 1xc0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KNS)