|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KNS) |
Sites (0, 0)| (no "Site" information available for 2KNS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KNS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KNS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KNS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KNS) |
Exons (0, 0)| (no "Exon" information available for 2KNS) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:33 aligned with PAP4_PARMA | P81861 from UniProtKB/Swiss-Prot Length:33 Alignment length:33 10 20 30 PAP4_PARMA 1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE 33 SCOP domains --------------------------------- SCOP domains CATH domains --------------------------------- CATH domains Pfam domains Pardaxin-2knsA01 A:1-33 Pfam domains SAPs(SNPs) --------------------------------- SAPs(SNPs) PROSITE --------------------------------- PROSITE Transcript --------------------------------- Transcript 2kns A 1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE 33 10 20 30
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KNS) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KNS) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (PAP4_PARMA | P81861)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|