Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HIGH-RESOLUTION SOLUTION STRUCTURE OF THE ASIC1A BLOCKER PCTX1
 
Authors :  G. F. King, M. Mobli, N. J. Saez
Date :  25 Aug 09  (Deposition) - 01 Sep 10  (Release) - 30 Jan 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (25x)
NMR Structure *:  A  (1x)
Keywords :  Psalmotoxin 1, Pi-Theraphotoxin-Pc1A, Cystine Knot, Spider Toxin, Peptide Toxin, Disulfide Bond, Ionic Channel Inhibitor, Knottin, Neurotoxin, Secreted, Asic1A Inhibitor, Acid Sensing Ion Channel 1A Inhibitor, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. J. Saez, M. Mobli, M. Bieri, I. R. Chassagnon, A. K. Malde, R. Gamsjaeger, A. E. Mark, P. R. Gooley, L. D. Rash, G. F. King
A Dynamic Pharmacophore Drives The Interaction Between Psalmotoxin-1 And The Putative Drug Target Acid-Sensing Ion Channel 1A.
Mol. Pharmacol. V. 80 796 2011
PubMed-ID: 21825095  |  Reference-DOI: 10.1124/MOL.111.072207
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PSALMOTOXIN-1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector: PLICC
    Organism Common: TRINIDAD CHEVRON TARANTULA
    Organism Scientific: PSALMOPOEUS CAMBRIDGEI
    Organism Taxid: 179874
    Synonym: PCTX1

 Structural Features

(-) Chains, Units

  1
NMR Structure (25x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KNI)

(-) Sites  (0, 0)

(no "Site" information available for 2KNI)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:19
2A:11 -A:24
3A:18 -A:34

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KNI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KNI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KNI)

(-) Exons   (0, 0)

(no "Exon" information available for 2KNI)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:41
 aligned with TXP1_PSACA | P60514 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:41
                             1                                       
                             |       9        19        29        39 
            TXP1_PSACA    - -EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT 40
               SCOP domains d2knia_ A: automated matches              SCOP domains
               CATH domains ----------------------------------------- CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .............hhhhh...eeee.......eeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
                 Transcript ----------------------------------------- Transcript
                  2kni A  1 SEDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT 41
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KNI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2KNI)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (TXP1_PSACA | P60514)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kni)
 
  Sites
(no "Sites" information available for 2kni)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kni)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kni
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TXP1_PSACA | P60514
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TXP1_PSACA | P60514
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TXP1_PSACA | P60514: 1lmm 3s3x 4fz0 4fz1

(-) Related Entries Specified in the PDB File

1lmm RELATED ID: 16468 RELATED DB: BMRB