Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE TGS DOMAIN OF PG1808 FROM PORPHYROMONAS GINGIVALIS. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PGR122A (418-481)
 
Authors :  Y. Yang, T. A. Ramelot, J. R. Cort, D. Lee, C. Ciccosanti, K. Hamilton, R. Nair, B. Rost, T. B. Acton, R. Xiao, G. Swapna, J. K. Everett, G. T. Montelione, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)
Date :  31 Jul 09  (Deposition) - 10 Nov 09  (Release) - 10 Nov 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Methods Development, Tgs Domain, Predominantly Beta-Sheet Structure, Porphyromonas Gingivalis, Hydrolase, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Yang, T. A. Ramelot, J. R. Cort, D. Lee, C. Ciccosanti, K. Hamilton, R. Nair, B. Rost, T. B. Acton, R. Xiao, G. Swapna, J. K. Everett, G. T. Montelione, M. A. Kennedy
Solution Nmr Structure Of The Tgs Domain Of Pg1808 From Porphyromonas Gingivalis. Northeast Structural Genomics Consortium Target Pgr122A (418-481)
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GUANOSINE-3',5'-BIS(DIPHOSPHATE) 3'- PYROPHOSPHOHYDROLASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3) PMGK
    Expression System Taxid562
    Expression System VectorPET 21-23C
    FragmentSEQUENCE DATABASE RESIDUES 418-481
    GenePG1808, PG_1808, SPOT
    Organism ScientificPORPHYROMONAS GINGIVALIS
    Organism Taxid837

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KMM)

(-) Sites  (0, 0)

(no "Site" information available for 2KMM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KMM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KMM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KMM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KMM)

(-) Exons   (0, 0)

(no "Exon" information available for 2KMM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:73
 aligned with Q7MAV5_PORGI | Q7MAV5 from UniProtKB/TrEMBL  Length:762

    Alignment length:161
                                   426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576 
         Q7MAV5_PORGI   417 NEVMVFTPKGEIKRLPQGATALDFAYSLHSDLGDHCIGAKVNHKLVPLSYVLNSGDQVEVLSSKSQQPTEEWLRYVTTARAKSKVDTFLRRKRRELINRGEERVVSVIRTSESMVSAELLDRIAAYFGFLNRETFFYAVGTGTVSLPESFKKLLQGEHSGN 577
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --TGS-2kmmA01 A:419-478                                       --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.....eeee....hhhhhhhhhhhhhhhheeeeee..ee............eeeee...----------------------------------------------------------------------------------------........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kmm A 417 MEVMVFTPKGEIKRLPQGATALDFAYSLHSDLGDHCIGAKVNHKLVPLSYVLNSGDQVEVLSSKS----------------------------------------------------------------------------------------LEHHHHHH 489
                                   426       436       446       456       466       476    |    -         -         -         -         -         -         -         -         -   |   488 
                                                                                          481                                                                                      482       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KMM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KMM)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (Q7MAV5_PORGI | Q7MAV5)
molecular function
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0015969    guanosine tetraphosphate metabolic process    The chemical reactions and pathways involving guanine tetraphosphate (5'-ppGpp-3'), a derivative of guanine riboside with four phosphates.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kmm)
 
  Sites
(no "Sites" information available for 2kmm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kmm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kmm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7MAV5_PORGI | Q7MAV5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7MAV5_PORGI | Q7MAV5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KMM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KMM)