|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KM6) |
Sites (0, 0)| (no "Site" information available for 2KM6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KM6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KM6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KM6) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KM6) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:96 aligned with NALP7_HUMAN | Q8WX94 from UniProtKB/Swiss-Prot Length:980 Alignment length:96 10 20 30 40 50 60 70 80 90 NALP7_HUMAN 1 MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQ 96 SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains -----PYRIN-2km6A01 A:8-91 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE DAPIN PDB: A:3-95 UniProt: 1-93 --- PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 2km6 A 3 MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQ 98 12 22 32 42 52 62 72 82 92
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KM6) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KM6) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (NALP7_HUMAN | Q8WX94)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|