|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KJ8) |
Sites (0, 0)| (no "Site" information available for 2KJ8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KJ8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KJ8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KJ8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KJ8) |
Exons (0, 0)| (no "Exon" information available for 2KJ8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:118 aligned with INTS_ECOLI | P37326 from UniProtKB/Swiss-Prot Length:385 Alignment length:118 96 106 116 126 136 146 156 166 176 186 196 INTS_ECOLI 87 SSNNNSFSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQLLEVIRRFEDRGAMERANKARRRCGEVFRYAIVTGRAKYNPAPDLADAMKGYRKKNFPFLPADQ 204 SCOP domains ---------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains DUF------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 2kj8 A 1 SSNNNSFSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQLLEVIRRFEDRGAMERANKARRRCGEVFRYAIVTGRAKYNPAPDLADAMKGYRKKNLEHHHHHH 118 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KJ8) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KJ8) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (9, 9)|
NMR Structure(hide GO term definitions) Chain A (INTS_ECOLI | P37326)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|