2KIU - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF THE DNA-BINDING DOMAIN OF FOXP1: INSIGHT INTO ITS DOMAIN SWAPPING

Authors :   W. Chuang, Y. Chu

Date :   11 May 09 (Deposition) - 21 Apr 10 (Release) - 27 Apr 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)
NMR Structure *: A  (1x)

Keywords :   Solution Structure Of The Monomeric Foxp1, Dna-Binding, Metal- Binding, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription Regulation, Zinc-Finger, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. P. Chu, C. H. Chang, J. H. Shiu, Y. T. Chang, C. Y. Chen, W. J. Chuang
Solution Structure And Backbone Dynamics Of The Dna-Binding Domain Of Foxp1: Insight Into Its Domain Swapping And Dna Binding.
Protein Sci. V. 20 908 2011
PubMed-ID: 21416545 | Reference-DOI: 10.1002/PRO.626

Molecule 1 - FORKHEAD BOX PROTEIN P1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector	:	PET21D(+)
	Expression System Vector Type	:	VECTOR
	Fragment	:	DNA BINDING DOMAIN (UNP RESIDUES 462-548)
	Gene	:	3P14.1, FOXP1, HSPC215
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FOXP1

		1
NMR Structure (20x)	:	A
NMR Structure * (1x)	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2KIU)

(no "Site" information available for 2KIU)

(no "SS Bond" information available for 2KIU)

(no "Cis Peptide Bond" information available for 2KIU)

NMR Structure (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075247	R	465	G	FOXP1_HUMAN	Disease (MRLIAF)	869025202	A	R	4	G
2	UniProt	VAR_075248	R	514	C	FOXP1_HUMAN	Disease (MRLIAF)	869025203	A	R	53	C
3	UniProt	VAR_075249	W	534	R	FOXP1_HUMAN	Disease (MRLIAF)	587777855	A	W	73	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075247	R	465	G	FOXP1_HUMAN	Disease (MRLIAF)	869025202	A	R	4	G
2	UniProt	VAR_075248	R	514	C	FOXP1_HUMAN	Disease (MRLIAF)	869025203	A	R	53	C
3	UniProt	VAR_075249	W	534	R	FOXP1_HUMAN	Disease (MRLIAF)	587777855	A	W	73	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FORK_HEAD_3	PS50039	Fork head domain profile.	FOXP1_HUMAN	465-538	1	A:4-77
2	FORK_HEAD_2	PS00658	Fork head domain signature 2.	FOXP1_HUMAN	509-515	1	A:48-54

NMR Structure * (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FORK_HEAD_3	PS50039	Fork head domain profile.	FOXP1_HUMAN	465-538	1	A:4-77
2	FORK_HEAD_2	PS00658	Fork head domain signature 2.	FOXP1_HUMAN	509-515	1	A:48-54

(no "Exon" information available for 2KIU)

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:87
 aligned with FOXP1_HUMAN | Q9H334 from UniProtKB/Swiss-Prot  Length:677

    Alignment length:87
                                   471       481       491       501       511       521       531       541       
          FOXP1_HUMAN   462 AEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQK 548
               SCOP domains --------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---Fork_head-2kiuA01 A:4-87                                                             Pfam domains
         Sec.struct. author .......hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..eeee......eeeehhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---G------------------------------------------------C-------------------R-------------- SAPs(SNPs)
                PROSITE (1) ---FORK_HEAD_3  PDB: A:4-77 UniProt: 465-538                                 ---------- PROSITE (1)
                PROSITE (2) -----------------------------------------------FORK_HE--------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------- Transcript
                 2kiu A   1 AEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFPYFRRNAATWKNAVRHNLSLHKYFVRVENVKGAVWTVDEVEFQKRRPQK  87
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2KIU)

(no "CATH Domain" information available for 2KIU)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Fork_head] (7)

Family: Fork_head (7)

Homo sapiens (Human) (6)

Fork_head-2kiuA01

A:4-87

NMR Structure(hide GO term definitions)

Chain A (FOXP1_HUMAN | Q9H334)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0050681	androgen receptor binding	Interacting selectively and non-covalently with an androgen receptor.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043621	protein self-association	Interacting selectively and non-covalently with a domain within the same polypeptide.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0061470	T follicular helper cell differentiation	The process in which a relatively unspecialized T cell acquires specialized features of a mature T follicular helper cell.
	GO:0035926	chemokine (C-C motif) ligand 2 secretion	The regulated release of chemokine (C-C motif) ligand 2 (CCL2) from a cell.
	GO:0042118	endothelial cell activation	The change in morphology and behavior of an endothelial cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0072619	interleukin-21 secretion	The regulated release of interleukin-21 from a cell.
	GO:0042116	macrophage activation	A change in morphology and behavior of a macrophage resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0042117	monocyte activation	The change in morphology and behavior of a monocyte resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0002903	negative regulation of B cell apoptotic process	Any process that stops, prevents, or reduces the frequency, rate, or extent of B cell apoptotic process.
	GO:0060766	negative regulation of androgen receptor signaling pathway	Any process that decreases the rate, frequency, or extent of the androgen receptor signaling pathway.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0036035	osteoclast development	The process whose specific outcome is the progression of a osteoclast from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a specific fate. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
	GO:0030316	osteoclast differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of an osteoclast. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
	GO:0010595	positive regulation of endothelial cell migration	Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0048661	positive regulation of smooth muscle cell proliferation	Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
	GO:1900424	regulation of defense response to bacterium	Any process that modulates the frequency, rate or extent of defense response to bacterium.
	GO:1901509	regulation of endothelial tube morphogenesis	Any process that modulates the frequency, rate or extent of endothelial tube morphogenesis.
	GO:0050727	regulation of inflammatory response	Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
	GO:0050706	regulation of interleukin-1 beta secretion	Any process that modulates the frequency, rate or extent of the regulated release of interleukin-1 beta from a cell.
	GO:2001182	regulation of interleukin-12 secretion	Any process that modulates the frequency, rate or extent of interleukin-12 secretion.
	GO:1901256	regulation of macrophage colony-stimulating factor production	Any process that modulates the frequency, rate or extent of macrophage colony-stimulating factor production.
	GO:0045655	regulation of monocyte differentiation	Any process that modulates the frequency, rate or extent of monocyte differentiation.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032680	regulation of tumor necrosis factor production	Any process that modulates the frequency, rate, or extent of tumor necrosis factor production.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kiu)

	Sites
(no "Sites" information available for 2kiu)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kiu)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2kiu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FOXP1_HUMAN \| Q9H334
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613670
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FOXP1_HUMAN \| Q9H334
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2KIU)

(no "Related Entries Specified in the PDB File" available for 2KIU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (35, 35)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File