Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  ALPHA-AMYLASE INHIBITOR PARVULUSTAT (Z-2685) FROM STREPTOMYCES PARVULUS
 
Authors :  S. Rehm, S. Han, I. Hassani, A. Sokocevic, H. R. A. Jonker, J. W. Engels, H. Schwalbe
Date :  02 Feb 09  (Deposition) - 17 Feb 09  (Release) - 17 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Alpha-Amylase Inhibitor, Parvulustat (Z-2685), Hydrolase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Rehm, S. Han, I. Hassani, A. Sokocevic, H. R. A. Jonker, J. W. Engels, H. Schwalbe
The High Resolution Nmr Structure Of Parvulustat (Z-2685) From Streptomyces Parvulus Fh-1641: Comparison With Tendamistat From Streptomyces Tendae 4158
Chembiochem V. 10 119 2009
PubMed-ID: 19067455  |  Reference-DOI: 10.1002/CBIC.200800547
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ALPHA-AMYLASE INHIBITOR Z-2685
    Chains: A
    Engineered: YES
    Expression System: STREPTOMYCES LIVIDANS
    Expression System Strain: TK24
    Expression System Taxid: 1916
    Expression System Vector: PAX5A
    Expression System Vector Type: VECTOR
    Organism Scientific: STREPTOMYCES PARVULUS
    Organism Taxid: 146923
    Strain: FH-1641
    Synonym: PARVULUSTAT

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KER)

(-) Sites  (0, 0)

(no "Site" information available for 2KER)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:9 -A:25
2A:43 -A:70

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KER)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KER)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KER)

(-) Exons   (0, 0)

(no "Exon" information available for 2KER)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with IAA_STRRO | P07512 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:78
                                                                                                      76  
                                    10        20        30        40        50        60        70     |  
             IAA_STRRO    1 ATGSPVAECVEYFQSWRYTDVHNGCADAVSVTVEYTHGQWAPCRVIEPGGWATFAGYGTDGNYVTGLHTCDPATPS--  -
               SCOP domains ------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------ CATH domains
               Pfam domains --A_amylase_inhib-2kerA01 A:3-70                                      -------- Pfam domains
         Sec.struct. author ..........eeee...eeeee......eeeeeee........eee......eee........eeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------ Transcript
                  2ker A  1 ATGSPVAECVEYFQSWRYTDVHNGCADAVSVTVEYTHGQWAPCRVIEPGGWATFAGYGTDGNYVTGLHTCDPATPSGV 78
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KER)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KER)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: A_amylase_inhib] (2)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (IAA_STRRO | P07512)
molecular function
    GO:0015066    alpha-amylase inhibitor activity    Stops, prevents or reduces the activity of alpha-amylase.
biological process
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ker)
 
  Sites
(no "Sites" information available for 2ker)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ker)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ker
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IAA_STRRO | P07512
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IAA_STRRO | P07512
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KER)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KER)