|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KEL) |
Sites (0, 0)| (no "Site" information available for 2KEL) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KEL) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KEL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KEL) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KEL) |
Exons (0, 0)| (no "Exon" information available for 2KEL) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with Y56B_SIRV1 | Q8QL46 from UniProtKB/Swiss-Prot Length:56 Alignment length:46 20 30 40 50 Y56B_SIRV1 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 SCOP domains ---------------------------------------------- SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains ---------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 2kel A 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 20 30 40 50 Chain B from PDB Type:PROTEIN Length:46 aligned with Y56B_SIRV1 | Q8QL46 from UniProtKB/Swiss-Prot Length:56 Alignment length:46 20 30 40 50 Y56B_SIRV1 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 SCOP domains ---------------------------------------------- SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains (1) RepB-RCR_reg-2kelB01 B:11-56 Pfam domains (1) Pfam domains (2) RepB-RCR_reg-2kelB02 B:11-56 Pfam domains (2) SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 2kel B 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KEL) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KEL) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A,B (Y56B_SIRV1 | Q8QL46)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|