Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE ANTIFUNGAL PROTEIN PAF FROM PENICILLIUM CHRYSOGENUM
 
Authors :  G. Batta, T. Barna, Z. Gaspari, S. Sandor, K. E. Kover, U. Binder, B. Sarg, L. Kaiserer, A. K. Chhillar, A. Eigentler, E. Leiter, N. Hegedus, I. Pocsi, H. Lindner, F. Marx
Date :  23 Dec 08  (Deposition) - 21 Jul 09  (Release) - 21 Jul 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Antifungal Protein Paf (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Batta, T. Barna, Z. Gaspari, S. Sandor, K. E. Kover, U. Binder, B. Sarg, L. Kaiserer, A. K. Chhillar, A. Eigentler, E. Leiter, N. Hegedus, I. Pocsi, H. Lindner, F. Marx
Functional Aspects Of The Solution Structure And Dynamics Of Paf--A Highly-Stable Antifungal Protein From Penicillium Chrysogenum
Febs J. V. 276 2875 2009
PubMed-ID: 19459942  |  Reference-DOI: 10.1111/J.1742-4658.2009.07011.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ANTIFUNGAL PROTEIN
    Chains: A
    Engineered: YES
    Fragment: UNP RESIDUES 38-92
    Gene: PAF
    Organism Common: PENICILLIUM NOTATUM
    Organism Scientific: PENICILLIUM CHRYSOGENUM
    Organism Taxid: 5076

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KCN)

(-) Sites  (0, 0)

(no "Site" information available for 2KCN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KCN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KCN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KCN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KCN)

(-) Exons   (0, 0)

(no "Exon" information available for 2KCN)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:55
 aligned with Q01701_PENCH | Q01701 from UniProtKB/TrEMBL  Length:92

    Alignment length:55
                                    47        57        67        77        87     
          Q01701_PENCH   38 AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD 92
               SCOP domains ------------------------------------------------------- SCOP domains
               CATH domains 2kcnA00 A:1-55  [code=2.40.50.60, no name defined]      CATH domains
               Pfam domains Antifungal_prot-2kcnA01 A:1-53                       -- Pfam domains
         Sec.struct. author .eeee.......eeeeee...eeeeee...............eeee....eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------- Transcript
                  2kcn A  1 AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD 55
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KCN)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Antifungal_prot] (1)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 2KCN)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kcn)
 
  Sites
(no "Sites" information available for 2kcn)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kcn)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kcn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q01701_PENCH | Q01701
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q01701_PENCH | Q01701
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q01701_PENCH | Q01701: 2mhv 2nb0 2nbf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KCN)