Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF A THIAMINE BIOSYNTHESIS PROTEIN FROM GEOBACTER METALLIREDUCENS: NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET GMR137
 
Authors :  R. Mani, H. Wang, M. Jiang, M. Magliaqui, R. Xiao, R. Nair, M. C. Baran, S. V. T. Gurla, T. B. Acton, B. Rost, G. T. Montelione, Northeast Structural Genomics Consortium (Nesg)
Date :  30 Jun 08  (Deposition) - 26 Aug 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nesg, Gmr137, Geobacter Metallireducens, Thiamine Biosynthesis, Nmr, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Mani, H. Wang, M. Jiang, M. Magliaqui, R. Xiao, R. Nair, M. C. Baran, S. V. T. Gurla, T. B. Acton, B. Rost, G. T. Montelione
Nmr Solution Structure Of A Thiamine Biosynthesis Protein From Geobacter Metallireducens: Northeast Structural Genomics Consortium Target Gmr137
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THIAMINE-BIOSYNTHESIS PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET 21-23C
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Vector Type: PLASMID
    Gene: GMET_1567
    Organism Scientific: GEOBACTER METALLIREDUCENS GS-15
    Organism Taxid: 269799
    Synonym: THIS PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K5P)

(-) Sites  (0, 0)

(no "Site" information available for 2K5P)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K5P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K5P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K5P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2K5P)

(-) Exons   (0, 0)

(no "Exon" information available for 2K5P)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with Q39VC5_GEOMG | Q39VC5 from UniProtKB/TrEMBL  Length:70

    Alignment length:78
                                                                                                70        
                                    10        20        30        40        50        60        70        
          Q39VC5_GEOMG    1 MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGGK--------  -
               SCOP domains ------------------------------------------------------------------------------ SCOP domains
               CATH domains 2k5pA00 A:1-78  [code=3.10.20.30, no name defined]                             CATH domains
               Pfam domains --ThiS-2k5pA01 A:3-69                                                --------- Pfam domains
         Sec.struct. author .eeee..eeee......eehhhhhhhhh........eee..ee...hhhhhhee.....eee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------ Transcript
                  2k5p A  1 MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGGKLEHHHHHH 78
                                    10        20        30        40        50        60        70        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K5P)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 2K5P)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k5p)
 
  Sites
(no "Sites" information available for 2k5p)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k5p)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k5p
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q39VC5_GEOMG | Q39VC5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q39VC5_GEOMG | Q39VC5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q39VC5_GEOMG | Q39VC5: 3cwi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K5P)