Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF FEOA PROTEIN FROM CHLOROBIUM TEPIDUM. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CTR121
 
Authors :  A. Eletsky, B. Sathyamoorthy, J. L. Mills, A. Zeri, L. Zhao, K. Hamilton, E. L. Foote, R. Xiao, R. Nair, M. C. Baran, G. V. T. Swapna, T. B. Acton, B. Rost, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Date :  27 Jun 08  (Deposition) - 19 Aug 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sh3-Like, Alpha+Beta, Gft, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Eletsky, B. Sathyamoorthy, J. L. Mills, A. Zeri, L. Zhao, K. Hamilton, E. L. Foote, R. Xiao, R. Nair, M. C. Baran, G. V. T. Swapna, T. B. Acton, B. L. Rost, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of Feoa Protein From Chlorobium Tepidum. Northeast Structural Genomics Consortium Target Ctr121
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FERROUS IRON TRANSPORT PROTEIN A
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET 21-23C
    Expression System Strain: BL21(DE3)+ MAGIC
    Expression System Vector Type: PLASMID
    Gene: FEOA-2, CT0057
    Organism Scientific: CHLOROBACULUM TEPIDUM
    Organism Taxid: 1097

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K5F)

(-) Sites  (0, 0)

(no "Site" information available for 2K5F)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K5F)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Asp A:48 -Pro A:49

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K5F)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2K5F)

(-) Exons   (0, 0)

(no "Exon" information available for 2K5F)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:105
 aligned with Q8KGB1_CHLTE | Q8KGB1 from UniProtKB/TrEMBL  Length:97

    Alignment length:105
                                                                                                                           97        
                                    10        20        30        40        50        60        70        80        90      |  -     
         Q8KGB1_CHLTE     1 MKLSELKAGDRAEVTSVAAEPAVRRRLMDLGLVRGAKLKVLRFAPLGDPIEVNCNGMLLTMRRNEAEGITVHILAGDEGHPHGWPGFRRRHRFGKRA--------   -
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains FeoA-2k5fA01 A:1-73                                                      -------------------------------- Pfam domains
         Sec.struct. author .hhhhh....eeeeeee..hhhhhhhhhhhh.....eeeeeee......eeeee..eeeeehhhhhhheeeee................................ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 2k5f A   1 MKLSELKAGDRAEVTSVAAEPAVRRRLMDLGLVRGAKLKVLRFAPLGDPIEVNCNGMLLTMRRNEAEGITVHILAGDEGHPHGWPGFRRRHRFGKRALEHHHHHH 105
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K5F)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2K5F)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: TRB (15)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q8KGB1_CHLTE | Q8KGB1)
molecular function
    GO:0046914    transition metal ion binding    Interacting selectively and non-covalently with a transition metal ions; a transition metal is an element whose atom has an incomplete d-subshell of extranuclear electrons, or which gives rise to a cation or cations with an incomplete d-subshell. Transition metals often have more than one valency state. Biologically relevant transition metals include vanadium, manganese, iron, copper, cobalt, nickel, molybdenum and silver.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k5f)
 
  Sites
(no "Sites" information available for 2k5f)
 
  Cis Peptide Bonds
    Asp A:48 - Pro A:49   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k5f
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8KGB1_CHLTE | Q8KGB1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8KGB1_CHLTE | Q8KGB1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2K5F)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K5F)