|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2K47) |
Sites (0, 0)| (no "Site" information available for 2K47) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2K47) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2K47) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2K47) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2K47) |
Exons (0, 0)| (no "Exon" information available for 2K47) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:73 aligned with PHOSP_VSIVA | P03520 from UniProtKB/Swiss-Prot Length:265 Alignment length:73 265 204 214 224 234 244 254 264| PHOSP_VSIVA 195 SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSL-- - SCOP domains ------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------- CATH domains Pfam domains Phosphoprotein-2k47A01 A:1-67 ------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 2k47 A 1 SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLE 73 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2K47) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2K47) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (PHOSP_VSIVA | P03520)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|