Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CSMA
 
Authors :  M. Pedersen, J. Dittmer, J. Underhaug, M. Miller, N. C. Nielsen
Date :  23 Apr 08  (Deposition) - 02 Sep 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (9x)
Keywords :  Protein, Bacteriochlorophyll, Chlorophyll, Chlorosome, Chromophore, Electron Transport, Magnesium, Metal-Binding, Photosynthesis, Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. O. Pedersen, J. Underhaug, J. Dittmer, M. Miller, N. C. Nielsen
The Three-Dimensional Structure Of Csma: A Small Antenna Protein From The Green Sulfur Bacterium Chlorobium Tepidum.
Febs Lett. V. 582 2869 2008
PubMed-ID: 18652828  |  Reference-DOI: 10.1016/J.FEBSLET.2008.07.020
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHLOROSOME PROTEIN A
    Chains: A
    Fragment: RESIDUES 1-59
    Organism Scientific: CHLOROBIUM TEPIDUM
    Synonym: BACTERIOCHLOROPHYLL C-BINDING PROTEIN, BCHL C- BINDING

 Structural Features

(-) Chains, Units

  
NMR Structure (9x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K37)

(-) Sites  (0, 0)

(no "Site" information available for 2K37)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K37)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K37)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K37)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2K37)

(-) Exons   (0, 0)

(no "Exon" information available for 2K37)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:59
 aligned with CSMA_CHLTE | P0A314 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:59
                                    10        20        30        40        50         
            CSMA_CHLTE    1 MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS 59
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains 2k37A00 A:1-59 bacteriochlorophyll c-binding protein        CATH domains
               Pfam domains -Bac_chlorC-2k37A01 A:2-59                                  Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                  2k37 A  1 MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS 59
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K37)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Bac_chlorC] (1)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (CSMA_CHLTE | P0A314)
molecular function
    GO:0042314    bacteriochlorophyll binding    Interacting selectively and non-covalently with bacteriochlorophyll, a form of chlorophyll found in photosynthetic bacteria, such as the purple and green bacteria. There are several types, designated a to g. Bacteriochlorophyll a and bacteriochlorophyll b are structurally similar to the chlorophyll a and chlorophyll b found in plants.
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0046858    chlorosome    A large enclosure of aggregated pigment, typically bacteriochlorophyll c (BChl c), that acts as a light-harvesting antenna structure and is characteristic of green photosynthetic bacteria (e.g. Chlorobiaceae). The BChl aggregates are organized into lamellar elements by pigment-pigment rather than pigment-protein interactions. Chlorosomes also contain BChl a, carotenoids, quinones, lipids, and proteins, and are attached to the cytoplasmic membrane via a BChl a-containing protein baseplate.
    GO:0033105    chlorosome envelope    The structure, composed of a monolayer of glycolipids with embedded proteins, that encloses the pigments and other contents of the chlorosome.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k37)
 
  Sites
(no "Sites" information available for 2k37)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k37)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k37
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSMA_CHLTE | P0A314
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CSMA_CHLTE | P0A314
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CSMA_CHLTE | P0A314: 5lcb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K37)