|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2K1W) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2K1W) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2K1W) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2K1W) |
Exons (0, 0)| (no "Exon" information available for 2K1W) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:85 aligned with Q8TMX3_METAC | Q8TMX3 from UniProtKB/TrEMBL Length:120 Alignment length:85 45 55 65 75 85 95 105 115 Q8TMX3_METAC 36 VNAAEVIVYEHVNFGGKSFDATSDQPGAGDNLNDKISSIKVKSGTWRFYEYINYGGRYWDLGPGEYSSVESAGIPDNSISSFRQI 120 SCOP domains d2k1wa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains ----Crystall-2k1wA01 A:5-85 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2k1w A 1 MNAAEVIVYEHVNFGGKSFDATSDQPGAGDNLNDKISSIKVKSGTWRFYEYINYGGRYWDLGPGEYSSVESAGIPDNSISSFRQI 85 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2K1W) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (Q8TMX3_METAC | Q8TMX3)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|