Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF ALG13: THE SUGAR DONOR SUBUNIT OF A YEAST N-ACETYLGLUCOSAMINE TRANSFERASE. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET YG1
 
Authors :  X. Wang, T. Weldeghorghis, G. Zhang, B. Imepriali, G. T. Montelione, J. H. Prestegard, Northeast Structural Genomics Consortium (Nesg)
Date :  04 Jan 08  (Deposition) - 19 Feb 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Rossmann-Like Fold, Endoplasmic Reticulum, Glycosyltransferase, Transferase, Structural Genomics, Psi- 2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Wang, T. Weldeghiorghis, G. Zhang, B. Imperiali, J. H. Prestegard
Solution Structure Of Alg13: The Sugar Donor Subunit Of A Yeast N-Acetylglucosamine Transferase.
Structure V. 16 965 2008
PubMed-ID: 18547528  |  Reference-DOI: 10.1016/J.STR.2008.03.010
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UDP-N-ACETYLGLUCOSAMINE TRANSFERASE SUBUNIT ALG13
    Atcc204508
    ChainsA
    EC Number2.4.1.141
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneALG13, YGL047W
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    StrainS288C
    SynonymASPARAGINE-LINKED GLYCOSYLATION PROTEIN 13

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JZC)

(-) Sites  (0, 0)

(no "Site" information available for 2JZC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JZC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JZC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JZC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JZC)

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YGL047W1YGL047W.1VII:411555-412163609ALG13_YEAST1-2022021A:24-224201

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with ALG13_YEAST | P53178 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:201
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201 
          ALG13_YEAST     2 GIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS 202
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2jzcA00 A:24-224 Glycogen Phosphorylase B;                                                                                                                                                                CATH domains
               Pfam domains ------Glyco_tran_28_C-2jzcA01 A:30-222                                                                                                                                                                 -- Pfam domains
         Sec.struct. author .......eeee......hhhhhhhhhhhhhhhhhhh.....eee...........hhhhhhh.ee................eeee......eeee.....hhhhhhhhhh..eee..hhhhhhhhhhh.....ee.......hhhhhhhhhhhhhh...ee.....hhhhhhhhhh.............hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:24-224 UniProt: 1-202 [INCOMPLETE]                                                                                                                                                       Transcript 1
                 2jzc A  24 GIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS 224
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JZC)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: GT-B (132)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)
Chain A   (ALG13_YEAST | P53178)
molecular function
    GO:0004577    N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity    Catalysis of the reaction: UDP-N-acetyl-D-glucosamine + N-acetyl-D-glucosaminyl-diphosphodolichol = UDP + N,N''-diacetylchitobiosyldiphosphodolichol.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016757    transferase activity, transferring glycosyl groups    Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
    GO:0016758    transferase activity, transferring hexosyl groups    Catalysis of the transfer of a hexosyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006488    dolichol-linked oligosaccharide biosynthetic process    The chemical reactions and pathways resulting in the formation of dolichol-linked oligosaccharide, usually by a stepwise addition of glycosyl chains to endoplasmic reticulum membrane-bound dolichol-P.
cellular component
    GO:0043541    UDP-N-acetylglucosamine transferase complex    A multienzyme, heterooligomeric complex involved in dolichyl-linked oligosaccharide synthesis. In yeast the complex is composed of Alg7p, which catalyzes the first step (GlcNAc1-PP-Dol from dolichol-phosphate and UDP-GlcNAc), and Alg13p plus Alg14p, the catalytic and anchoring subunits respectively, which together catalyze the second step (GlcNAc2-PP-dolichol from GlcNAc1-PP-Dol and UDP-GlcNAc) of dolichyl-linked oligosaccharide synthesis.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0042406    extrinsic component of endoplasmic reticulum membrane    The component of the endoplasmic reticulum membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jzc)
 
  Sites
(no "Sites" information available for 2jzc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jzc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jzc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALG13_YEAST | P53178
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.1.141
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ALG13_YEAST | P53178
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALG13_YEAST | P531782ks6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JZC)