|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JZA) |
Sites (0, 0)| (no "Site" information available for 2JZA) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JZA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JZA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JZA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JZA) |
Exons (0, 0)| (no "Exon" information available for 2JZA) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:130 aligned with Q6CZS1_PECAS | Q6CZS1 from UniProtKB/TrEMBL Length:122 Alignment length:130 122 10 20 30 40 50 60 70 80 90 100 110 120 | - Q6CZS1_PECAS 1 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLP-------- - SCOP domains d2jzaa1 A:1-122 NADH-nitrite reductase small subunit NirD -------- SCOP domains CATH domains 2jzaA01 A:1-118 'Rieske'-like iron-sulphur domains ------------ CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript 2jza A 1 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLPLEHHHHHH 130 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2JZA) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (Q6CZS1_PECAS | Q6CZS1)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|