Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF NITRITE REDUCTASE [NAD(P)H] SMALL SUBUNIT FROM ERWINIA CAROTOVORA. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET EWR120
 
Authors :  B. Sathyamoorthy, A. Eletsky, D. Wang, K. Stokes, L. Owens, R. Xiao, J. Liu, M. C. Baran, G. V. T. Swapna, T. B. Acton, B. Rost, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Date :  31 Dec 07  (Deposition) - 22 Jan 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Isp Domain, Rieske Iron-Sulfur Protein, 3-Layer Beta- Sandwich, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Nird, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Sathyamoorthy, A. Eletsky, D. Wang, K. Stokes, L. Owens, R. Xiao, J. Liu, M. C. Baran, G. V. T. Swapna, T. B. Acton, B. Rost, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of Nitrite Reductase [Nad(P)H] Small Subunit From Erwinia Carotovora.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NITRITE REDUCTASE [NAD(P)H] SMALL SUBUNIT
    AtccBAA-672
    ChainsA
    EC Number1.7.1.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21-23C
    Expression System StrainBL21(DE3)+MAGIC
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneNIRD, ECA4080
    Organism ScientificPECTOBACTERIUM ATROSEPTICUM SCRI1043
    Organism Taxid218491
    StrainSCRI 1043

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JZA)

(-) Sites  (0, 0)

(no "Site" information available for 2JZA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JZA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JZA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JZA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JZA)

(-) Exons   (0, 0)

(no "Exon" information available for 2JZA)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:130
 aligned with Q6CZS1_PECAS | Q6CZS1 from UniProtKB/TrEMBL  Length:122

    Alignment length:130
                                                                                                                                                   122        
                                    10        20        30        40        50        60        70        80        90       100       110       120 |       -
         Q6CZS1_PECAS     1 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLP--------   -
               SCOP domains d2jzaa1 A:1-122 NADH-nitrite reductase small subunit NirD                                                                 -------- SCOP domains
               CATH domains 2jzaA01 A:1-118 'Rieske'-like iron-sulphur domains                                                                    ------------ CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..........eeee..eeeeee........eee...............eeee....eeee......eee..................eee...eeeee....................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2jza A   1 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLPLEHHHHHH 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2JZA)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (Q6CZS1_PECAS | Q6CZS1)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0008942    nitrite reductase [NAD(P)H] activity    Catalysis of the reaction: ammonium hydroxide + 3 NAD(P)+ + H2O = nitrite + 3 NAD(P)H + 3 H+.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0042128    nitrate assimilation    The nitrogen metabolic process that encompasses the uptake of nitrate from the environment and reduction to ammonia, and results in the incorporation of nitrogen derived from nitrate into cellular substances.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jza)
 
  Sites
(no "Sites" information available for 2jza)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jza)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jza
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6CZS1_PECAS | Q6CZS1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.7.1.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6CZS1_PECAS | Q6CZS1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2JZA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JZA)