2JZ4 - JenaLib

Title :   PUTATIVE 32 KDA MYROSINASE BINDING PROTEIN AT3G16450.1 FROM ARABIDOPSIS THALIANA

Authors :   N. Takeda, N. Sugimori, T. Torizawa, T. Terauchi, A. M. Ono, H. Yagi, Y. Yamaguchi, K. Kato, T. Ikeya, P. Guntert, D. J. Aceti, J. L. Markley, M. Kainosho, Center For Eukaryotic Structural Genomics (Cesg)

Date :   28 Dec 07 (Deposition) - 19 Feb 08 (Release) - 09 Jun 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Myrosinase Binding Protein, At3G16450. 1, Sail, Stereo-Array Isotope Labeling, Structural Genomics, Psi-2, Protein Structure Initiative, Center For Eukaryotic Structural Genomics, Cesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Takeda, N. Sugimori, T. Torizawa, T. Terauchi, A. M. Ono, H. Yagi, Y. Yamaguchi, K. Kato, T. Ikeya, J. Jee, P. Guntert, D. J. Aceti, J. L. Markley, M. Kainosho
Structure Of The Putative 32 Kda Myrosinase-Binding Protein From Arabidopsis (At3G16450. 1) Determined By Sail-Nmr.
Febs J. V. 275 5873 2008
PubMed-ID: 19021763 | Reference-DOI: 10.1111/J.1742-4658.2008.06717.X
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:299
 aligned with JAL33_ARATH | O04311 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:299
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291         
          JAL33_ARATH     2 AQKVEAGGGAGGASWDDGVHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTLLGFETFEVDADDYIVAVQVTYDNVFGQDSDIITSITFNTFKGKTSPPYGLETQKKFVLKDKNGGKLVGFHGRAGEALYALGAYFATTTTPVTPAKKLSAIGGDEGTAWDDGAYDGVKKVYVGQGQDGISAVKFEYNKGAENIVGGEHGKPTLLGFEEFEIDYPSEYITAVEGTYDKIFGSDGLIITMLRFKTNKQTSAPFGLEAGTAFELKEEGHKIVGFHGKASELLHQFGVHVMPLTN 300
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2jz4A01 A:1-148  [code=2.100.10.30, no name defined]                                                                                                2jz4A02 A:149-299  [code=2.100.10.30, no name defined]                                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................eeeeee....eeeeee.ee....ee...eee.........ee......eeeeeeeee........eeeeeeeee...............eeeee..........................................................eeeeee....eeeeeee.....................eee...........eeeeeee......eeeeeeee.........ee....eeeee....ee...eeeee...eeeeee..ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE JACALIN_LECTIN  PDB: A:1-145 UniProt: 2-146                                                                                                      -------JACALIN_LECTIN  PDB: A:153-296 UniProt: 154-297                                                                                                 --- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2jz4 A   1 AQKVEAGGGAGGASWDDGVHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTLLGFETFEVDADDYIVAVQVTYDNVFGQDSDIITSITFNTFKGKTSPPYGLETQKKFVLKDKNGGKLVGFHGRAGEALYALGAYFATTTTPVTPAKKLSAIGGDEGTAWDDGAYDGVKKVYVGQGQDGISAVKFEYNKGAENIVGGEHGKPTLLGFEEFEIDYPSEYITAVEGTYDKIFGSDGLIITMLRFKTNKQTSAPFGLEAGTAFELKEEGHKIVGFHGKASELLHQFGVHVMPLTN 299
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

NMR Structure(hide GO term definitions)

Chain A (JAL33_ARATH | O04311)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
biological process
	GO:0009409	response to cold	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cold stimulus, a temperature stimulus below the optimal temperature for that organism.
	GO:0010043	response to zinc ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0009506	plasmodesma	A fine cytoplasmic channel, found in all higher plants, that connects the cytoplasm of one cell to that of an adjacent cell.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jz4)

	Sites
(no "Sites" information available for 2jz4)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jz4)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2jz4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	JAL33_ARATH \| O04311
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description