|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JZ2) |
Sites (0, 0)| (no "Site" information available for 2JZ2) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JZ2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JZ2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JZ2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JZ2) |
Exons (0, 0)| (no "Exon" information available for 2JZ2) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:66 aligned with P74795_SYNY3 | P74795 from UniProtKB/TrEMBL Length:58 Alignment length:66 58 10 20 30 40 50 | - P74795_SYNY3 1 MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPI-------- - SCOP domains ------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains DUF3252-2jz2A01 A:1-53 ------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2jz2 A 1 MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPILEHHHHHH 66 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JZ2) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2JZ2) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JZ2)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|