Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION CONFORMATION OF RNA-BOUND NELF-E RRM
 
Authors :  N. Jampani, K. Schweimer, S. Wenzel, B. M. Woehrl, P. Roesch
Date :  02 Nov 07  (Deposition) - 08 Apr 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nelfe-Rrm, Coiled Coil, Nucleus, Phosphorylation, Repressor, Rna-Binding, Transcription, Transcription Regulation, Ubl Conjugation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. N. Rao, K. Schweimer, S. Wenzel, B. M. Wohrl, P. Rosch
Nelf-E Rrm Undergoes Major Structural Changes In Flexible Protein Regions On Target Rna Binding
Biochemistry V. 47 3756 2008
PubMed-ID: 18303858  |  Reference-DOI: 10.1021/BI702429M
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NEGATIVE ELONGATION FACTOR E
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET15B
    Expression System Vector TypeVECTOR
    FragmentRRM DOMAIN
    GeneRDBP, NELFE, RD
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNELF-E, RNA-BINDING PROTEIN RD

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JX2)

(-) Sites  (0, 0)

(no "Site" information available for 2JX2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JX2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JX2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JX2)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.NELFE_HUMAN262-332  1A:40-110

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.18aENST0000038334318aENSE00001809819HSCHR6_MHC_QBL:31917261-31917061201NELFE_HUMAN-00--
1.18qENST0000038334318qENSE00002158378HSCHR6_MHC_QBL:31916623-3191654183NELFE_HUMAN1-25250--
1.20aENST0000038334320aENSE00001779968HSCHR6_MHC_QBL:31915179-3191511070NELFE_HUMAN26-49240--
1.20cENST0000038334320cENSE00001731569HSCHR6_MHC_QBL:31915007-31914862146NELFE_HUMAN49-97490--
1.21adENST0000038334321adENSE00001639990HSCHR6_MHC_QBL:31913467-3191339375NELFE_HUMAN98-122250--
1.22bENST0000038334322bENSE00001607333HSCHR6_MHC_QBL:31913270-3191323338NELFE_HUMAN123-135130--
1.22fENST0000038334322fENSE00001650692HSCHR6_MHC_QBL:31913066-31912729338NELFE_HUMAN135-2481140--
1.23bENST0000038334323bENSE00001661527HSCHR6_MHC_QBL:31912616-31912472145NELFE_HUMAN248-296491A:35-7440
1.24cENST0000038334324cENSE00001703897HSCHR6_MHC_QBL:31912308-3191225455NELFE_HUMAN296-314191A:74-9219
1.24jENST0000038334324jENSE00001793271HSCHR6_MHC_QBL:31912005-31911903103NELFE_HUMAN315-349351A:93-12129
1.25dENST0000038334325dENSE00001916146HSCHR6_MHC_QBL:31910572-31910261312NELFE_HUMAN349-380320--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with NELFE_HUMAN | P18615 from UniProtKB/Swiss-Prot  Length:380

    Alignment length:87
                                   266       276       286       296       306       316       326       336       
          NELFE_HUMAN   257 APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKS 343
               SCOP domains d2jx2a_ A: Negative elongation factor E, NELF-E                                         SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------RRM_1-2jx2A01 A:45-104                                      ----------------- Pfam domains
         Sec.struct. author .....eeeeee....hhhhhhhhhh....eeeeeee....eeeeee.hhhhhhhhhhhhh.ee....eeeeee.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----RRM  PDB: A:40-110 UniProt: 262-332                                    ----------- PROSITE
           Transcript 1 (1) Exon 1.23b  PDB: A:35-74 [INCOMPLETE]   ------------------Exon 1.24j  PDB: A:93-121     Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.24c         ----------------------------- Transcript 1 (2)
                 2jx2 A  35 APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKS 121
                                    44        54        64        74        84        94       104       114       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JX2)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: RRM (206)

(-) Gene Ontology  (20, 20)

NMR Structure(hide GO term definitions)
Chain A   (NELFE_HUMAN | P18615)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:1900364    negative regulation of mRNA polyadenylation    Any process that stops, prevents or reduces the frequency, rate or extent of mRNA polyadenylation.
    GO:0034244    negative regulation of transcription elongation from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0051571    positive regulation of histone H3-K4 methylation    Any process that activates or increases the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0050434    positive regulation of viral transcription    Any process that activates or increases the frequency, rate or extent of viral transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006368    transcription elongation from RNA polymerase II promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0032021    NELF complex    A complex of five proteins, designated NELF-A, -B, -C, -D, and -E in human, that can physically associate with RNP polymerase II to induce transcriptional pausing.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jx2)
 
  Sites
(no "Sites" information available for 2jx2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jx2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jx2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NELFE_HUMAN | P18615
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NELFE_HUMAN | P18615
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NELFE_HUMAN | P186151x5p 2bz2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JX2)