Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SPATIAL SRTUCTURE OF TERNARY COMPLEX KALATA B7/MN2+/DPC MICELLE
 
Authors :  K. D. Nadezhdin, Z. O. Shenkarev, L. Skjeldal, A. S. Arseniev
Date :  16 Oct 07  (Deposition) - 11 Mar 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Cyclotide, Cyctine Knot, Divalent Cation-Binding Site, Cytolysis, Hemolysis, Knottin, Plant Defense, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. O. Shenkarev, K. D. Nadezhdin, E. N. Lyukmanova, V. A. Sobol, L. Skjeldal, A. S. Arseniev
Divalent Cation Coordination And Mode Of Membrane Interaction In Cyclotides: Nmr Spatial Structure Of Ternary Complex Kalata B7/Mn(2+)/Dpc Micelle
J. Inorg. Biochem. V. 102 1246 2008
PubMed-ID: 18295894  |  Reference-DOI: 10.1016/J.JINORGBIO.2008.01.018
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KALATA-B7
    ChainsA
    Organism ScientificOLDENLANDIA AFFINIS
    Organism Taxid60225

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JWM)

(-) Sites  (0, 0)

(no "Site" information available for 2JWM)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:1 -A:15
2A:5 -A:17
3A:10 -A:22

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Trp A:19 -Pro A:20

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JWM)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYCLOTIDE_MOEBIUSPS60009 Cyclotides Moebius subfamily signature.KAB7_OLDAF80-89  1A:1-10

(-) Exons   (0, 0)

(no "Exon" information available for 2JWM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:29
 aligned with KAB7_OLDAF | P58457 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:30
                                    89        99       109
           KAB7_OLDAF    80 CGETCTLGTCYTQGCTCSWPICKRNGLPDV 109
               SCOP domains d2jwma_ A: automated matches   SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains Cyclotide-2jwmA01 A:1-25 ----- Pfam domains
         Sec.struct. author ...............eee..eee.....-. Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE CYCLOTIDE_-------------------- PROSITE
                 Transcript ------------------------------ Transcript
                 2jwm A   1 CGETCTLGTCYTQGCTCSWPICKRNGLP-V  29
                                    10        20       |29
                                                      28 |
                                                        29

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JWM)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (KAB7_OLDAF | P58457)
biological process
    GO:0019835    cytolysis    The rupture of cell membranes and the loss of cytoplasm.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0044179    hemolysis in other organism    The cytolytic destruction of red blood cells, with the release of intracellular hemoglobin, in one organism by another.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jwm)
 
  Sites
(no "Sites" information available for 2jwm)
 
  Cis Peptide Bonds
    Trp A:19 - Pro A:20   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jwm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAB7_OLDAF | P58457
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAB7_OLDAF | P58457
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAB7_OLDAF | P584572m9o 2mw0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JWM)