|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JWL) |
Sites (0, 0)| (no "Site" information available for 2JWL) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JWL) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JWL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JWL) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JWL) |
Exons (0, 0)| (no "Exon" information available for 2JWL) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:74 aligned with TOLR_HAEIN | P43769 from UniProtKB/Swiss-Prot Length:139 Alignment length:74 66 76 86 96 106 116 126 TOLR_HAEIN 57 DKVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK 130 SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2jwl A 19 GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK 92 28 38 48 58 68 78 88 Chain B from PDB Type:PROTEIN Length:74 aligned with TOLR_HAEIN | P43769 from UniProtKB/Swiss-Prot Length:139 Alignment length:74 66 76 86 96 106 116 126 TOLR_HAEIN 57 DKVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK 130 SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------- CATH domains Pfam domains (1) --ExbD-2jwlB01 B:21-92 Pfam domains (1) Pfam domains (2) --ExbD-2jwlB02 B:21-92 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2jwl B 19 GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK 92 28 38 48 58 68 78 88
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JWL) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2JWL) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A,B (TOLR_HAEIN | P43769)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|