Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF STEREO-ARRAY ISOTOPE LABELLED (SAIL) C-TERMINAL DIMERIZATION DOMAIN OF SARS CORONAVIRUS NUCLEOCAPSID PROTEIN
 
Authors :  M. Takeda, C. Chang, T. Ikeya, P. Guntert, Y. Chang, Y. Hsu, T. Huang, M. Kainosho
Date :  06 Oct 07  (Deposition) - 26 Aug 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
Keywords :  Sail, Sars Coronavirus Nucleocapsid Protein, Nucleocapsid Packaging, Cytoplasm, Golgi Apparatus, Phosphorylation, Rna- Binding, Viral Nucleoprotein, Virion, Structural Protein, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Takeda, C. K. Chang, T. Ikeya, Y. H. Chang, Y. L. Hsu, T. H. Huang, M. Kainosho
Solution Structure Of The C-Terminal Dimerization Domain Of Sars Coronavirus Nucleocapsid Protein Solved By The Sail-Nmr Method
J. Mol. Biol. V. 380 608 2008
PubMed-ID: 18561946  |  Reference-DOI: 10.1016/J.JMB.2007.11.093
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NUCLEOCAPSID PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: CELL-FREE SYNTHESIS
    Expression System Vector: PET
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 248-365
    Organism Common: SARS-COV
    Organism Scientific: HUMAN SARS CORONAVIRUS
    Organism Taxid: 227859
    Synonym: N PROTEIN, NC

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JW8)

(-) Sites  (0, 0)

(no "Site" information available for 2JW8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JW8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JW8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JW8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JW8)

(-) Exons   (0, 0)

(no "Exon" information available for 2JW8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:118
 aligned with NCAP_CVHSA | P59595 from UniProtKB/Swiss-Prot  Length:422

    Alignment length:118
                                   257       267       277       287       297       307       317       327       337       347       357        
           NCAP_CVHSA   248 TKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFP 365
               SCOP domains d2jw8a_ A: automated matches                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.............hhhhhh...............hhhhhhhhh.hhhhhhh...hhhhhh.....eeeee..eeeeeeeeeee......hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2jw8 A 248 TKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFP 365
                                   257       267       277       287       297       307       317       327       337       347       357        


Chain B from PDB  Type:PROTEIN  Length:118
 aligned with NCAP_CVHSA | P59595 from UniProtKB/Swiss-Prot  Length:422

    Alignment length:118
                                   257       267       277       287       297       307       317       327       337       347       357        
           NCAP_CVHSA   248 TKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFP 365
               SCOP domains d2jw8b_ B: automated matches                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Corona_nucleoca-2jw8B01 B:248-365                                                                                      Pfam domains (1)
           Pfam domains (2) Corona_nucleoca-2jw8B02 B:248-365                                                                                      Pfam domains (2)
         Sec.struct. author ....hhhhh.............hhhhhh.....hhhhh.....hhhhhhhhh..hhhhhh...hhhhhh.....eeeee..eeeeeeeeee.......hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2jw8 B 248 TKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFP 365
                                   257       267       277       287       297       307       317       327       337       347       357
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JW8)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: no clan defined [family: Corona_nucleoca] (4)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A,B   (NCAP_CVHSA | P59595)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
cellular component
    GO:0044177    host cell Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic host cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack.
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044172    host cell endoplasmic reticulum-Golgi intermediate compartment    A complex system of membrane-bounded compartments located between host cell endoplasmic reticulum (ER) and the host Golgi complex, with a distinctive membrane protein composition; involved in ER-to-Golgi transport.
    GO:0044220    host cell perinuclear region of cytoplasm    The host cell cytoplasm situated near, or occurring around, the host nucleus.
    GO:0019013    viral nucleocapsid    The complete protein-nucleic acid complex that is the packaged form of the genome in a virus particle.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jw8)
 
  Sites
(no "Sites" information available for 2jw8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jw8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jw8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NCAP_CVHSA | P59595
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NCAP_CVHSA | P59595
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NCAP_CVHSA | P59595: 1ssk 1x7q 2cjr 2gib 2ofz 2og3 3i6l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JW8)