Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NOGO54
 
Authors :  M. Li, J. Song
Date :  12 Sep 07  (Deposition) - 16 Sep 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nogo54, Alternative Splicing, Endoplasmic Reticulum, Membrane, Phosphorylation, Transmembrane, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Li, J. Song
Structure-Based Design Of Buffer-Soluble Nogo54: A Molecular Mimic Of Nogo-66 To Inhibit Cns Neuron Regeneration
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RETICULON-4
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1055-1108
    GeneRTN4, KIAA0886, NOGO
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEURITE OUTGROWTH INHIBITOR, NOGO PROTEIN, FOOCEN, NEUROENDOCRINE-SPECIFIC PROTEIN, NSP, NEUROENDOCRINE- SPECIFIC PROTEIN C HOMOLOG, RTN-X, RETICULON-5

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JV5)

(-) Sites  (0, 0)

(no "Site" information available for 2JV5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JV5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JV5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JV5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JV5)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.6bENST000003375266bENSE00001330411chr2:55277680-55276881800RTN4_HUMAN1-1861860--
1.11ENST0000033752611ENSE00001665808chr2:55255356-5525530057RTN4_HUMAN186-205200--
1.12bENST0000033752612bENSE00001754629chr2:55254621-552522222400RTN4_HUMAN205-10058010--
1.14aENST0000033752614aENSE00001330486chr2:55214834-55214627208RTN4_HUMAN1005-1074701A:1-2020
1.15ENST0000033752615ENSE00000753314chr2:55209789-55209651139RTN4_HUMAN1074-1120471A:20-5435
1.16ENST0000033752616ENSE00000809957chr2:55201900-5520183170RTN4_HUMAN1121-1144240--
1.17cENST0000033752617cENSE00000809956chr2:55201003-5520095747RTN4_HUMAN1144-1159160--
1.17dENST0000033752617dENSE00001276893chr2:55200757-5520069959RTN4_HUMAN1160-1179200--
1.18eENST0000033752618eENSE00001555275chr2:55200334-551993251010RTN4_HUMAN1179-1192140--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:54
 aligned with RTN4_HUMAN | Q9NQC3 from UniProtKB/Swiss-Prot  Length:1192

    Alignment length:54
                                  1064      1074      1084      1094      1104    
          RTN4_HUMAN   1055 RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRR 1108
               SCOP domains ------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------ CATH domains
               Pfam domains Reticulon-2jv5A01 A:1-54                               Pfam domains
         Sec.struct. author ......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.14a          ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.15  PDB: A:20-54             Transcript 1 (2)
                2jv5 A    1 RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRR   54
                                    10        20        30        40        50    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JV5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JV5)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (26, 26)

NMR Structure(hide GO term definitions)
Chain A   (RTN4_HUMAN | Q9NQC3)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007413    axonal fasciculation    The collection of axons into a bundle of rods, known as a fascicle.
    GO:0060317    cardiac epithelial to mesenchymal transition    A transition where a cardiac epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0021801    cerebral cortex radial glia guided migration    The radial migration of neuronal or glial precursor cells along radial glial cells during the development of the cerebral cortex.
    GO:0071787    endoplasmic reticulum tubular network formation    The aggregation, arrangement and bonding together of a set of components to form the endoplasmic reticulum (ER) tubular network. The ER tubular network is the ER part that comprises the membranes with high curvature in cross-section.
    GO:0071786    endoplasmic reticulum tubular network organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the endoplasmic reticulum (ER) tubular network. The ER tubular network is the ER part that that has membranes with high curvature in cross-section.
    GO:0030517    negative regulation of axon extension    Any process that stops, prevents, or reduces the frequency, rate or extent of axon outgrowth.
    GO:0050771    negative regulation of axonogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of axonogenesis.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0051292    nuclear pore complex assembly    The aggregation, arrangement and bonding together of a set of components to form a nuclear pore complex.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:2000172    regulation of branching morphogenesis of a nerve    Any process that modulates the frequency, rate or extent of branching morphogenesis of a nerve.
    GO:0030334    regulation of cell migration    Any process that modulates the frequency, rate or extent of cell migration.
    GO:0051960    regulation of nervous system development    Any process that modulates the frequency, rate or extent of nervous system development, the origin and formation of nervous tissue.
cellular component
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0030176    integral component of endoplasmic reticulum membrane    The component of the endoplasmic reticulum membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005635    nuclear envelope    The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jv5)
 
  Sites
(no "Sites" information available for 2jv5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jv5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jv5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RTN4_HUMAN | Q9NQC3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RTN4_HUMAN | Q9NQC3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RTN4_HUMAN | Q9NQC32g31

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JV5)