2JSO - JenaLib

Title :   ANTIMICROBIAL RESISTANCE PROTEIN

Authors :   C. Jin, W. Fu

Date :   10 Jul 07 (Deposition) - 04 Sep 07 (Release) - 13 Jul 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (21x)
NMR Structure *: A  (1x)

Keywords :   Protein, Antibiotic Resistance, Transcription, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Fu, F. Yang, X. Kang, X. Zhang, Y. Li, B. Xia, C. Jin
First Structure Of The Polymyxin Resistance Proteins.
Biochem. Biophys. Res. Commun. V. 361 1033 2007
PubMed-ID: 17686460 | Reference-DOI: 10.1016/J.BBRC.2007.07.144

Compounds

Molecule 1 - POLYMYXIN RESISTANCE PROTEIN PMRD
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI K12
	Expression System Strain	:	K12
	Expression System Taxid	:	83333
	Expression System Vector	:	PET21A(+)
	Gene	:	PMRD
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	83333
	Strain	:	K12
	Synonym	:	BASR/PMRA POSTTRANSCRIPTIONAL ACTIVATOR, SIGNAL TRANSDUCTION PROTEIN PMRD

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 10)

NMR Structure (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_PMRD_ECOLI_001 *	N	11	D	PMRD_ECOLI	---	---	A	N	11	D
02	UniProt	VAR_PMRD_ECOLI_002 *	D	14	N	PMRD_ECOLI	---	---	A	D	14	N
03	UniProt	VAR_PMRD_ECOLI_003 *	L	19	I	PMRD_ECOLI	---	---	A	L	19	I
04	UniProt	VAR_PMRD_ECOLI_004 *	M	20	K	PMRD_ECOLI	---	---	A	M	20	K
05	UniProt	VAR_PMRD_ECOLI_005 *	A	27	T	PMRD_ECOLI	---	---	A	A	27	T
06	UniProt	VAR_PMRD_ECOLI_006 *	S	71	C	PMRD_ECOLI	---	---	A	S	71	C
07	UniProt	VAR_PMRD_ECOLI_007 *	C	81	S	PMRD_ECOLI	---	---	A	C	81	S
08	UniProt	VAR_PMRD_ECOLI_008 *	K	82	T	PMRD_ECOLI	---	---	A	K	82	T
09	UniProt	VAR_PMRD_ECOLI_009 *	V	83	A	PMRD_ECOLI	---	---	A	V	83	A
10	UniProt	VAR_PMRD_ECOLI_010 *	A	84	E	PMRD_ECOLI	---	---	A	A	84	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_PMRD_ECOLI_001 *	N	11	D	PMRD_ECOLI	---	---	A	N	11	D
02	UniProt	VAR_PMRD_ECOLI_002 *	D	14	N	PMRD_ECOLI	---	---	A	D	14	N
03	UniProt	VAR_PMRD_ECOLI_003 *	L	19	I	PMRD_ECOLI	---	---	A	L	19	I
04	UniProt	VAR_PMRD_ECOLI_004 *	M	20	K	PMRD_ECOLI	---	---	A	M	20	K
05	UniProt	VAR_PMRD_ECOLI_005 *	A	27	T	PMRD_ECOLI	---	---	A	A	27	T
06	UniProt	VAR_PMRD_ECOLI_006 *	S	71	C	PMRD_ECOLI	---	---	A	S	71	C
07	UniProt	VAR_PMRD_ECOLI_007 *	C	81	S	PMRD_ECOLI	---	---	A	C	81	S
08	UniProt	VAR_PMRD_ECOLI_008 *	K	82	T	PMRD_ECOLI	---	---	A	K	82	T
09	UniProt	VAR_PMRD_ECOLI_009 *	V	83	A	PMRD_ECOLI	---	---	A	V	83	A
10	UniProt	VAR_PMRD_ECOLI_010 *	A	84	E	PMRD_ECOLI	---	---	A	A	84	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:88
 aligned with PMRD_ECOLI | P37590 from UniProtKB/Swiss-Prot  Length:88

    Alignment length:88
                                    10        20        30        40        50        60        70        80        
            PMRD_ECOLI    1 MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAGKTQ 88
               SCOP domains ---------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------- CATH domains
               Pfam domains PmrD-2jsoA01 A:1-82                                                               ------ Pfam domains
         Sec.struct. author ..eeeeeee.......eeeeeee......eeeeeee........ee......eeee..eeeeeeeeeeeee.hhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------D--N----IK------T-------------------------------------------C---------STAE---- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------- Transcript
                  2jso A  1 MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAGKTQ 88
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (1, 1)

NMR Structure(hide GO term definitions)

Chain A (PMRD_ECOLI | P37590)

biological process
	GO:0046677		response to antibiotic		Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jso)

	Sites
(no "Sites" information available for 2jso)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jso)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2jso
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PMRD_ECOLI \| P37590
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PMRD_ECOLI \| P37590
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description